SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000005644 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000005644
Domain Number 1 Region: 3-164
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.05e-43
Family G proteins 0.00000288
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000005644   Gene: ENSECAG00000007462   Transcript: ENSECAT00000007674
Sequence length 203
Comment pep:known chromosome:EquCab2:1:69008087:69015518:-1 gene:ENSECAG00000007462 transcript:ENSECAT00000007674 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WSGDGILGKTSLVVSYTNRYPTEYIPTAFNFSAVVSVDGRPVRLQLCDTAGQDEFDKLRP
LCYTNTDIFLLCFSVVSPSSFQNVSEKWVPEIRCHCPKAPIILVGTQSDLREDVKVLIEL
DKCKEKPVPEEAAKLCAEEIKAASYVECSALTQKNLKEVFDAAIVAGIQYSDSQQQPKKS
KSRTPDKMKNLSKSWWKTYCCFV
Download sequence
Identical sequences F7BU65
ENSECAP00000005644 9796.ENSECAP00000005644 ENSECAP00000005644

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]