SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000005725 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000005725
Domain Number 1 Region: 135-183
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000135
Family EGF-type module 0.0095
Further Details:      
 
Domain Number 2 Region: 96-131
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000393
Family EGF-type module 0.0086
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000005725
Domain Number - Region: 46-71
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00362
Family EGF-type module 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000005725   Gene: ENSECAG00000007731   Transcript: ENSECAT00000007762
Sequence length 185
Comment pep:known chromosome:EquCab2:10:10180273:10328640:1 gene:ENSECAG00000007731 transcript:ENSECAT00000007762 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PAPGLRPPRAAPPPAPSRCGAGFRRPCSPLEGSHSSPAACRAGCSSEHGFCEQPGECRCL
EGWTGPLCTVPVSTSSCLSPRGPSSATPGCLVPGPGPCDGNPCANGGSCSETPGSFECAC
PRGFYGLRCEVSGVTCADGPCFNGGLCVGGADPDSAYICHCPPGFQGSNCEKRVDRCSLQ
PCRNG
Download sequence
Identical sequences F7DLM4
9796.ENSECAP00000005725 ENSECAP00000005725 ENSECAP00000005725

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]