SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000005772 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000005772
Domain Number 1 Region: 1587-1695
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-34
Family Spermadhesin, CUB domain 0.00027
Further Details:      
 
Domain Number 2 Region: 888-1003
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-33
Family Spermadhesin, CUB domain 0.00053
Further Details:      
 
Domain Number 3 Region: 241-343
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.31e-32
Family Spermadhesin, CUB domain 0.00067
Further Details:      
 
Domain Number 4 Region: 1938-2047
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.4e-32
Family Spermadhesin, CUB domain 0.00046
Further Details:      
 
Domain Number 5 Region: 725-829
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.53e-32
Family Spermadhesin, CUB domain 0.00046
Further Details:      
 
Domain Number 6 Region: 2105-2225
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.37e-32
Family Spermadhesin, CUB domain 0.00071
Further Details:      
 
Domain Number 7 Region: 2276-2395
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.36e-31
Family Spermadhesin, CUB domain 0.00097
Further Details:      
 
Domain Number 8 Region: 65-171
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.22e-29
Family Spermadhesin, CUB domain 0.00043
Further Details:      
 
Domain Number 9 Region: 1407-1523
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.53e-28
Family Spermadhesin, CUB domain 0.00073
Further Details:      
 
Domain Number 10 Region: 548-658
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.75e-27
Family Spermadhesin, CUB domain 0.001
Further Details:      
 
Domain Number 11 Region: 1067-1176
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.09e-25
Family Spermadhesin, CUB domain 0.0011
Further Details:      
 
Domain Number 12 Region: 1240-1349
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.88e-25
Family Spermadhesin, CUB domain 0.001
Further Details:      
 
Domain Number 13 Region: 1755-1870
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.57e-24
Family Spermadhesin, CUB domain 0.0043
Further Details:      
 
Domain Number 14 Region: 3168-3239
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5.4e-21
Family Complement control module/SCR domain 0.00077
Further Details:      
 
Domain Number 15 Region: 2450-2566
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.53e-20
Family Spermadhesin, CUB domain 0.002
Further Details:      
 
Domain Number 16 Region: 2813-2881
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 7.42e-19
Family Complement control module/SCR domain 0.00085
Further Details:      
 
Domain Number 17 Region: 2870-2938
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.97e-18
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 18 Region: 2928-3001
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.05e-18
Family Complement control module/SCR domain 0.00084
Further Details:      
 
Domain Number 19 Region: 3109-3179
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5.42e-18
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 20 Region: 3052-3120
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 9.17e-18
Family Complement control module/SCR domain 0.00093
Further Details:      
 
Domain Number 21 Region: 2754-2823
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.31e-17
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 22 Region: 3228-3297
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 8.36e-17
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 23 Region: 485-556
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000153
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 24 Region: 2627-2694
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000208
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 25 Region: 3287-3343
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000025
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 26 Region: 2223-2292
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000283
Family Complement control module/SCR domain 0.00094
Further Details:      
 
Domain Number 27 Region: 3348-3416
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000347
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 28 Region: 2984-3045
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000005
Family Complement control module/SCR domain 0.00097
Further Details:      
 
Domain Number 29 Region: 2565-2638
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000181
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 30 Region: 1009-1069
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000378
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 31 Region: 2051-2113
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000391
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 32 Region: 1527-1591
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000432
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 33 Region: 1700-1765
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000001
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 34 Region: 663-722
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000139
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 35 Region: 1877-1943
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000292
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 36 Region: 177-238
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000634
Family Complement control module/SCR domain 0.00082
Further Details:      
 
Domain Number 37 Region: 1182-1244
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000104
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 38 Region: 1353-1415
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000133
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 39 Region: 3407-3465
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000195
Family Complement control module/SCR domain 0.0026
Further Details:      
 
Domain Number 40 Region: 834-901
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000337
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 41 Region: 2701-2765
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000528
Family Complement control module/SCR domain 0.0027
Further Details:      
 
Domain Number 42 Region: 2394-2457
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000702
Family Complement control module/SCR domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000005772   Gene: ENSECAG00000003727   Transcript: ENSECAT00000007815
Sequence length 3704
Comment pep:known chromosome:EquCab2:9:56334344:57508528:-1 gene:ENSECAG00000003727 transcript:ENSECAT00000007815 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKGIRKGESRAKESKPPEPSTRRCAKCGRLDFILMKKMRIKSGFTFWNLVFLLTVSCVKG
FIYTCGGTLKGLNGTIESPGFPYGYPNGANCTWVIIAEERNRIQIVFQSFALEEEYDYLS
LYDGHPHPTNFRTRLTGFHLPPPVTSTKSVFSLRLTSDFAVSAHGFKVYYEELQSSSCGN
PGVPPKGVLYGTRFDVGDKIRYSCVTGYILDGHPQLTCISNSVNTASWDFPVPICRAEDA
CGGTMRGSSGIISSPSFPNEYHNNADCTWTIVAEPGDTISLIFTDFQMEEKYDYLEIEGS
EPPTIWLSGMNIPPPIISNKNWLRLHFVTDSNHRYRGFSAPYQGSSTLTHTTSTGELEEH
NRTTTGAIAVASTSADVTVSSVTAVTIHRLSEEQRVQVTNLRNSGLDPNTSKDGLSPHEA
DTQSTRRRPRNAEQIERTKELAVVTHRVKKAIDFKSRGFKLFPGKDNSNKFSILNEGGIK
TASNLCPDPGEPENGKRIGSDFSLGSTVQFSCDEDYVLQGAKSITCQRIAEVFAAWSDHR
PVCKVKTCGSNLQGPSGTFTSPNFPFQYDSNAQCVWVITAVNTNKVIQINFEEFDLEIGY
DTLTIGDGGEVGDPRTVLQVLTGSFVPDLIVSMSSQMWLHLQTDESVGSVGFKVNYKEIE
KESCGDPGTPLYGIREGDGFSNRDVLRFECQFGFELIGEKSIVCQENNQWSANIPICIFP
CLSNFTAPMGTVLSPDYPEGYGNNLNCIWTIISDPGSRIHLSFNDFDLESQFDFLAVKDG
DSPDSPILGTFTGAEVPSHLTSNSHILRLEFQADHSMSGRGFNITYNTFGHNECPDPGIP
INARRFGDNFQLGSSISVICEEGFIKTQGTETITCILMDGKVMWSGPIPRCGAPCGGHFS
APSGLILSPGWPGYYKDSLNCEWVIEAEPGHSIKITFERFQTELNYDVLEVHDGPNLLSP
LLGSYNGTQVPQFLFSSSNFIYLLFTTDNSRSNNGFKIHYESVTVNTYSCLDPGIPVHGR
RYGHDFSIGSTVSFSCDPGYRLSHEEPLLCEKNHWWSHPLPTCDALCGGDVRGPSGTILS
PGYPEFYPNSLNCTWTVDVTHGKGVQFNFHTFHLEDHHDYLLITENGSFTQPLARLTGSE
LPSTINAGLYGNFRAQLRFISDFSISYEGFNITFSEYNLEPCEDPGIPQYGNRIGFNFGV
GDTLTFSCSLGYRLEGTSEIICLGGGRRVWSAPLPRCVAECGASATNNEGILLSPNYPLN
YENNHECIYSIQVQAGKGINISARTFHLAQGDVLKIYDGKDKTTHLLGAFTGASMRGLTL
SSTSNQLWLEFNSDSEGTDEGFQLVYTSFELSHCEDPGIPQFGYKISDQGHFAGSTIIYG
CNPGYTLHGSSLLKCMTGERRAWDYPLPSCIAECGGRFKGESSGRILSPGYPFPYDNNLR
CMWMIEVDPGNIVSLQFLAFDTEASHDILRVWDGPPENEMLLKEISGSLIPEGIHSTLNI
VTIQFDTDFYISKSGFAIQFSSSVATACRDPGVPMNGTRNGDGREPGDTVVFQCDPGYEL
QGEERITCIQVENRYFWQPSPPVCIAPCGGNLTGSSGFILSPNFPHPYPHSRDCDWTITV
NADYVISLAFISFSIEPNYDFLYIYDGPDSNSPLIGSFQDSKLPERIESSSNNMHLAFRS
DGSVSYTGFHLEYKAKLRESCFDPGNIMNGTRLGMDYKLGSTVTYYCDAGYVLQGYSTLT
CIMGDDGRPGWNRALPSCHAPCGSRSTGSEGTVLSPNYPKNYSVGHNCVYSIAVPKEFVV
FGQFVFFQTSLHDVVEVYDGPTQQSSLLSSLSGSHSGESLPLSSGNQITIRFTSVGPITA
KGFHFVYQAVPRTSSTQCSSVPEPRFGRRIGNEFAVGSLVLFECNPGYILHGSVAIRCDT
VPNSLAQWNDSLPTCIVPCGGILTKRKGTILSPGYPEPYDNNLNCVWKITVPEGAGIQVQ
VVSFATEHNWDSLDFYDGGDNNAPRLGSYSGTTIPHLLNSTSNNLYLNFQSDISVSAAGF
HLEYTAIGLDSCPEPQTPSSGIKIGDRYMVGDVVSFQCDQGYSLQGHSHITCMPGPVRRW
NYPIPICLAQCGGAMSDFSGVILSPGFPGNYPSSLDCTWTIKLPVGFGVHLQFVNFSTET
IHDYLEVRSGSSETSTVIGRLSGPQIPSSLFSTTHETSLYFHSDYSQNKQGFHIVYQAYQ
LQSCPDPRPFRNGFVIGNDFTVGQTISFECFPGYTLLGNSALTCLHGVSRNWNHPLPRCE
ALCGGNITAMNGTIYSPGYPDEYPNFQDCFWLVRVPPGNGIYINFTVLQTEPIYDFITVW
DGPDQNSPQIGQFSGNTALESVYSTSNQILIKFHSDFTTSGFFVLSYHAYQLRVCQPPPP
VPNAEILTEDDEFEIGDIIRYQCLPGFTLVGNAILTCRLGERLQMDGAPPVCQVLCPANE
LRLDSTGILSPGYPSYPNLQMCAWSISVEKGYNISMFIEFFQTEEFDVPQVYDGPNIQSP
VLISLSGDYSSAFNITSNGHEVFLQWSADHGNNKKGFRIRYIAFYCSTPESPPHGYIISQ
TGGQLNSVVRWACDRGFRLVGKSSAVCRKSSYGYHAWDAPVPACQAISCGIPKAPTNGGI
LTTDYLVGTRVTYFCNDGYRLSSKELTTAVCQSDGTWSNHNKTPRCVVVTCPSINSFTLE
HGRWRIVNGSHYEYKTKVVFSCDPGYHGLGPASIECLPNGTWSWRNERPYCQIISCGELP
TPPNGNKIGTQTSYGSTAIFTCDSGFMLVGSAVRECLSSGLWSGSETRCLAGHCGIPELI
VNGQVIGENYGYRDTVVYQCNPGFRLIGSSVRICQQDHNWSGQLPSCVPVSCGHPGSPIY
GRTSGNGFNFNDVVTFSCNIGYLMQGPTKAQCQANRQWSHPPPVCKVVNCSDPGIPANSK
RESKIEHGNFTYGTVVFYDCNPGYFLFGSSVLICQPNGQWDKPLPECIMIDCGHPGVPPN
AVLSGEKYTFGSTVHYSCTGKRTLLGQPSRTCQLNGHWSGSQPHCSGDATGTCGDPGTPG
HGSRQESDFRTKSSVRFACDTGYILHGSEERTCLANGSWTGRQPECKAVQCGNPGTTANG
KVFRIDGTTFSSSVIYSCMEGYVLSGPSVRQCTANGTWSGTLPNCTIISCGDPGIPANGL
RYGDDYVVGQNVSYMCQPGYTMELNGSRTRTCTTNGTWSGVMPTCRAVTCPTPPQISNGR
LEGTNFDWGFSISYICSPGYELSFPAVLTCVGNGTWSGEVPQCLPKFCGDPGIPAQGKRE
GKSFIYQSEVSFSCNSPFILVGSSTRICQADGTWSGSSPHCIEPTRTSCENPGVPRHGSQ
NNTFGFQVGSVVQFHCKKGHLLQGSTTRTCLPDLTWSGIQPECIPHSCKQPETPAHANVV
GMDLPSHGYTLIYTCQPGFFLAGGTEHRVCRSDNTWTGKVPVCEAGSKILVKDPRPALGT
PSPKLSVPDDVFAQNYIWKGSYNFKGKKQPMTLTVTSFNASTGRVNATLSNSNMELLLSG
VYKSQEARLMLHIYLIKVPTHASVKKMKEENWAMDGFVSAEPDGATYVFQGFIQGKDYGQ
FGLQRLGLNTSEGSNSSNQPHGTNSSSVAIAILVPFFALIFAGFGFYLYKQRTAPKTQYT
GCSVHENNNGQAAFENPMYDTNAKSVEGKAVRFDPNLNTVCTMV
Download sequence
Identical sequences F7DCR8
ENSECAP00000005772 9796.ENSECAP00000005772 ENSECAP00000005772

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]