SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000005853 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000005853
Domain Number 1 Region: 145-334
Classification Level Classification E-value
Superfamily E set domains 3.36e-53
Family Cytoplasmic domain of inward rectifier potassium channel 0.00021
Further Details:      
 
Domain Number 2 Region: 36-190
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.22e-24
Family Voltage-gated potassium channels 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000005853   Gene: ENSECAG00000007786   Transcript: ENSECAT00000007906
Sequence length 360
Comment pep:known chromosome:EquCab2:6:19774607:19783035:-1 gene:ENSECAG00000007786 transcript:ENSECAT00000007906 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDGSNCKVIAPLLTKRYRRMVTKDGHSTLQMDGAQRGLAYLRDAWGILMDMRWRWMMLVF
SASFVIHWLVFAVLWYVLAEMNGDLELDHDAPPENHTICVKYITSFTAAFSFSLETQLTI
GYGTMFPSGDCPSAIALLAIQMLLGLMLEAFITGAFVAKIARPKNRAFSIRFTDLAVVAH
TDGKPTLIFQVANTRPSPLTSVRVSAVLYQERENGKLYQTSVDFHLDGISSEECPFFIFP
LTYYHSITPSSPLATLLQRENPPHFELVVFLSAMQEGTGEICQRRTSYLPSEIMLHHCFA
SLLTRSSKGEYQIKMENFDKIVPELPTPLVSKSPNRTDLDIRINGQSIDNFQISETGLTE
Download sequence
Identical sequences F7CJ39
ENSECAP00000005853 XP_001499038.1.31192 XP_008539891.1.77740 XP_014595877.1.31192 ENSECAP00000005853 9796.ENSECAP00000005853

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]