SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000005969 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000005969
Domain Number 1 Region: 43-198
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.74e-21
Family MAM domain 0.0079
Further Details:      
 
Domain Number 2 Region: 238-339
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000586
Family MAM domain 0.013
Further Details:      
 
Domain Number 3 Region: 6-38
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000118
Family LDL receptor-like module 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000005969   Gene: ENSECAG00000007986   Transcript: ENSECAT00000008031
Sequence length 352
Comment pep:known chromosome:EquCab2:29:16607198:16673011:-1 gene:ENSECAG00000007986 transcript:ENSECAT00000008031 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LVQRGAEAFQCGNGVSLPPDNVCDFTDQCGDKSDEQQCSNYERCDFEDGLCSMIQDQSLR
LGWIKRNGMTGLSAPFYDHNGDMSAYFLSLVSKVNATFSNLRSRVFLPTNNQHVCQITFY
YFSSQGSGKLTAGLQTTCGGPIHHLWQNTVGSQNQWERNVIKIQSSQRFQVVFQGEMIST
HERDGVIAIDDISFSSGCLPANDEILPCQEASTTEQELCHPDTSLCRFDSTDEGLRLCQA
CGFDFDTCDWASEASAGQISWMRTKAREVPPLESVPQQDQNGDDEGSYIWVGAQHASALN
HSDNRAYLNSSVYHCVGKSCHLQFYYSMENSVLRVGLYNNKVRRNLHLFQIH
Download sequence
Identical sequences F7E4C9
9796.ENSECAP00000005969 ENSECAP00000005969 ENSECAP00000005969

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]