SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000006009 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000006009
Domain Number 1 Region: 224-377
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.76e-44
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000834
Further Details:      
 
Domain Number 2 Region: 116-214
Classification Level Classification E-value
Superfamily LCCL domain 2.88e-25
Family LCCL domain 0.00073
Further Details:      
 
Domain Number 3 Region: 3-112
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.28e-25
Family Spermadhesin, CUB domain 0.00088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000006009   Gene: ENSECAG00000007808   Transcript: ENSECAT00000008078
Sequence length 677
Comment pep:known chromosome:EquCab2:10:65904658:65946392:1 gene:ENSECAG00000007808 transcript:ENSECAT00000008078 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GDGCGHFVTYQDSGTMTSKNYPGTYPNHTVCEKTISVPKGKRLILRLGDLDIESQTCASD
YLLFTSSSHQYGPYCGSMTVPKELLLNTSEVTVRFESGSHISGRGFLLTYASSDHPDLIT
CLERANHYMKTEYSKFCPAGCRDIAGDISGNVVDGYRDTSLLCKAAIHAGIIADELGGQI
SVHQRKGLSRYEGILANGVLSRDGSLSDKRFLFTSNGCTRSLSLEPDRQIRASSSWQWVN
ETGGQVHWSPGQARLQDQGPSWASADSSKNHKQREWLEIDLGEKKKITGIRTAGSTQSNF
NFYVKSFVMSFKNNNSKWRTYKGIVNNGEKVFQGNSNFRDPVRNNFIPPIVARYVRVVPQ
TWHQRIALKVELIGCQITQGNDSMVWRKTSSDTVGSTKGEDETISEGIPSEEIPKGINVT
TVALPLALLALLVAGMGLFAALRKRKKKGSPYGSAKAQKTDCWKQIKYPFARHQSAEFTI
SYDNEKEMTQKLDLITSDMADYQQPLMIGTGTVTRKGSTFRPMDTEAGEAGPSAEAGSHY
DRPLPAGRHEYALPLTNPEPEYATPIVERHLARAHTFSAQSGYRVPGLRPAHKHSLSSGS
FSPAAGAGAMSAGYQMPQSPAPADPGYDKPKASSCVTADRADANYQKPQLHPTTGDAYST
PRDCLRPLNQTAMTALL
Download sequence
Identical sequences F6WEZ3
ENSECAP00000006009 ENSECAP00000006009 9796.ENSECAP00000006009

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]