SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000006045 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000006045
Domain Number 1 Region: 615-783
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.14e-29
Family Growth factor receptor domain 0.00034
Further Details:      
 
Domain Number 2 Region: 474-628
Classification Level Classification E-value
Superfamily Growth factor receptor domain 5.24e-28
Family Growth factor receptor domain 0.00057
Further Details:      
 
Domain Number 3 Region: 868-1025
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.26e-25
Family Growth factor receptor domain 0.00069
Further Details:      
 
Domain Number 4 Region: 2517-2637
Classification Level Classification E-value
Superfamily CalX-like 8.89e-25
Family CalX-beta domain 0.0009
Further Details:      
 
Domain Number 5 Region: 2882-3007
Classification Level Classification E-value
Superfamily CalX-like 1.1e-24
Family CalX-beta domain 0.0016
Further Details:      
 
Domain Number 6 Region: 3003-3147
Classification Level Classification E-value
Superfamily CalX-like 2.35e-24
Family CalX-beta domain 0.0013
Further Details:      
 
Domain Number 7 Region: 2763-2878
Classification Level Classification E-value
Superfamily CalX-like 2.35e-20
Family CalX-beta domain 0.0017
Further Details:      
 
Domain Number 8 Region: 387-490
Classification Level Classification E-value
Superfamily Growth factor receptor domain 6.44e-19
Family Growth factor receptor domain 0.00092
Further Details:      
 
Domain Number 9 Region: 2638-2763
Classification Level Classification E-value
Superfamily CalX-like 2.22e-17
Family CalX-beta domain 0.0022
Further Details:      
 
Domain Number 10 Region: 775-892
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.54e-17
Family Growth factor receptor domain 0.00069
Further Details:      
 
Domain Number 11 Region: 112-183
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000105
Family VWC domain 0.015
Further Details:      
 
Domain Number 12 Region: 47-120
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000046
Family VWC domain 0.01
Further Details:      
 
Domain Number 13 Region: 185-246
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000868
Family VWC domain 0.036
Further Details:      
 
Domain Number 14 Region: 243-310
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000251
Family VWC domain 0.01
Further Details:      
 
Domain Number 15 Region: 333-387
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000983
Family VWC domain 0.012
Further Details:      
 
Domain Number 16 Region: 3-54
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000806
Family VWC domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000006045   Gene: ENSECAG00000007044   Transcript: ENSECAT00000008119
Sequence length 3977
Comment pep:known chromosome:EquCab2:3:57929422:58192555:-1 gene:ENSECAG00000007044 transcript:ENSECAT00000008119 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQDATIWKPDSCQNCRCHGDIVICKPVVCRNPQCAFEKGEVLQIAANQCCPECVARTPGS
CHHEEKIHGHGTEWASSPCSVCSCTHGEVQCTPQPCPPLLCGHQELEFIPEGSCCPVCVG
PGKPCSYEGRVFQDGEDWPLSPCAKCVCRNGVAQCFTAQCQPLFCNQDETVVRVPGKCCP
QCSSRSCSAPGRVYEHGEQWSENACTTCICHQGEVRCHRQSCPPLRCKKGQKRAQRPGQC
CEECVSPAGSCLHNGIERYQDEMWKGSACEFCMCDRGQVTCQTGECAKVECAQGEELIHL
DGKCCPECISRNGYCAYEENAEFMSSNASEVKHIPEGEKWADGPCNVCECRRAQVTCYEP
SCPPCPVATLAQVVKGRCCPDCTSVHCHPDCLTCSQSPDHCDLCRDPTKMLRNGRCVHSC
GLGFYQAGALCLACQPQCSTCTSGLECSSCQPPLLMQHGQCVSTCGDGFYQDRHSCAACH
ESCAACWGPTEKHCLACRDPFQVLREGGCKSSCGDGFYNKQGTCSACDQSCKSCGPSSPR
CLTCTEKTVLHDGKCLSECAGGYYADATGKCKVCHNSCASCSGPTASHCTACSHHRALRQ
GHCVRDCGKGFYADHGVCKACYSSCLTCVGPEPSHCTQCKKPEEGLQVKQVPGANLTSGE
CLSQCRAQFYLENTGLCEACHQSCFGCSGKSRHNCTACRPSHALLDGRCLSQCPDGYFNQ
EDSCTECHPTCRQCHGPSESDCISCHPYVTLVGGKCRTSCREEQFFNLVGYCADCHPLCQ
HCAADLHNTGSICLRCQNARYLLLGDHCVPDCPSGYYAERGACKKCHSSCRTCQGRGPFS
CSSCDTDLVLSHLGTCSTTCFPGHYLDDNHACQPCSTHCGSCDSQGSCTSCRDPNKVLLF
GDCQYESCAPQYYLDFSTNTCKECDWSCNACSGPLRTDCLQCIEGYVLQDGACVEQCSPS
FYQDSGLCKSCNSHCLQCQGPHECTRCEGPFLLLEAQCVQECGKGYFAEHADHKCTACPR
ACLQCSRRDRCHLCGHGFFLKNGLCVSNCVPGLSAHSNDTCAGKTHTPSLHVNGSLSLAI
GSMKPLDFSLLNVQDQDGNIEDLLFHVVSTPTNGQLVLARNGKEVQLDKASHFSWKDVNA
KKVRFVHSKEKPRKGYFSLKISDQQFFSEPQLINIQAFSTQAPYVLRNEALHISRGGRGT
ITTQLLDIRDDDNPQDVVVEVLDPPLHGQLLQTLQSPASPIYQFRLDELSRGLLHYAHDG
SDSKSDVAVLQANDGHSFQNILFRVKTVPKNDGGLRLVANSMVWVPEGGMLQITNRILQA
EAPGASASEIVYKITQNHPHFGEVVLLVNMPADSPADEGQHLPDGRTAAPTSTFTQQDID
EGIVWYRHSGVPAQSDSFRFQVSSATDAHTQLESRVFNIAILPQMPDAPKLSLGASLHMT
AREDGLTVIQPHSLSFVNSERPSGKIIYNITLPLHPSQGIIEHKDQPHSPIRYFTQEDIN
QGKIMYRPPTAAPHLQEIMAFSFAGLPESVKFHFTVSDGEHTSPEMVLTIHLLPTDQLPA
TFQVTAPLLEVSPGGSTSIGLQLVVRDTETAPEELFFELRKPPQHGTLLKYTAESQGPMA
TGDTFTYEDIEKNVLQYLHDGSSAREDSMEISVTDGTSATTVEVRVEVSLSEDRGPRLAA
GASLSITVASKSTAVITRSHLAYVDDSSPDPEIWIQLSSLPMYGALLRTSGPEVEELSEV
SNFTMEDINNKKIRYLAVFETSSHLVTDSFHFSVSDMDHNRLDNQMFTIMITPLKNPPPV
IAFADLITVDEGGRAPLSFHHFFAADDHDNLQGDAVIKLSALPKYGCIENTGTGDRFGPG
MTSDLEASFPIQDVLENYIYYFQSVHESIEPTHDIFSFYVSDGNSRSEIHSINITIERKN
DEPPKMTLQPLRVRLSSGVVISNASLSLRDLDTPDNELIFVLTKKPDHGHLLQRQTASEP
LENGRVLAQGSSFTYQDVLAGLVGYMPGGPGVAVDEFQFSLTDGLHMGTGRMEIYIELPT
GDTPNLAVNRGLQLSAGSIARITEQHLKVIDTDSDDGLVMYIMKEDPGAGRLQMVKHDSL
ERISVQGPIRSFTQADISQGKVEYSHGKGESGGNFAFKFDVVDEEGNKLTDQSFSISVLE
DKSPPVITTNKGLVLDENSVKKITTLQLSATDQESEPAELIYRITRQPQLGHLELAASPG
IQISSFTQADLTSRNVQYIHSSEAEKHSDAFSFTLSDGVNEVTQTFHITLRPVDDSLPVV
HNLGMRVQEGVRKTITEFELKAVDADTEAESVTFTIVQPPRHGTIEHTTSGQRFQHTSTF
TMEDVYQNLVSYSHDGSNSLKDWFTFTVTDGTNSFFIIEEGGKELMTAAPQQFLVDILPV
DDGTPRIVTNLGLQWLEYMDGKATNLITKKELLTMDPDTEDPQLVYEITMGPKHGYVENK
LQPGRAAVTFTQEDVNLGLIRYMLHEEKIREMMDSFQFLVKDSKPNVVRDNVFHIQWSLI
SFKYTSYNVSEKAGSVSVTVQRTGNLNQYAIVLCRTKQGTASSSSRVSSQPGQQDYVEYA
GQVQFDEREDTKSCTIVINDDDIFENIESFTVELSMPAYALLGEFTQAKVIINDTEDEPT
LEFDKKTYRVNESAGFLFAPIERKGDSSSIVSAICYTIPKSAMGSSLYALESGSDFKSRG
MSAESRVIFGPGVIMSTCDVMLIDDSEYEEEEEFEIALADASDNARIGRVASAKVLINGP
NDASTVSLGNTAFTVSEDAGTVKIPVIRHGTDLSTFTSVWCATRPSDPASATPGVDYVPS
SRKVEFGPGVTEQYCTLTILDDTQYPVIEGLETFVVFLSSAQGAELTKPFQAVIAINDTY
QDVPSMQFAKDLLLVKEKEGVVHVPITRSGDLSYESSVRCYTQGHSAQVTEDFEERRNAD
SSRITFLKGEKMKNCTVFIHDDSMFEPEEQFRVYLGHPLGNHWSGARVGKNNMATVTVSN
DEDAPTIEFEEAAYQVREPSGPDAMAILNIKVIRRGDQNRTSKIRCSTRDGSAQSGVDYY
PKSRVLKFSPGVDHIFFKVEILSNEDREWHESFSLVLGPDDPVEAVLGDVTTATVTILDQ
EAAGSLILPAPPIVVTLADYDHVEEVTKEGVKKSPSPGYPLVCVTPCDPHFPKYAIMKER
CSEAGINQTSMQFSWEVAAPTDGNGARSPFETITDNTPFTSVNHMVLDSIYFSRRFHVRC
VAKAVDKVGHVGTPLRSNIVTIGTDSAICHTPVVAGTARGFQAQSFIATLKYLDVKHKEH
PNRIHISVQIPHQDGMLPLISTVPLHNLHFLLSESIYRHQHVCSNLVTTRDLRGISEAGF
LDDMVYDSTALGPGYDRPFQFDPSVREPKTIQLYKHLNLKSCVWTFDAYYDMTELIDVCG
GSVTADFQVRDSAQSFLTVHVPLYVSYIYVTAPRGWASLEHHTEMEFSFFYDTVLWRTGI
QTDSVLSARLQIIRIYIREDGRLVIEFKTHAKFRGQFVMEHHTLPDVKSFILTPDHLGGI
EFDLQLLWSAQTFDSPYQLWRATSSYNRKDYSGEYTIYLIPCTVQPTQPWVDPGDKPLAC
TAHAPERFLIPIAFQQTNRPVPVVYSLNTEFQLCNNEKVFLMDPNTSDMSLAEMDYKGAF
SKGQILYGRVLWNPEQNLNSAYKLQLEKVYLCTGKDGYVPFFDPTGTIYNEGPQYGCIQP
NKHLKHRFLLLDRSQPEVTDRYFHDVPFEAHFASELPDFHVVSSMPGVDGFTLKVDALYK
VEAGHQWYLQVIYIIGPDTISGPRVQRSLTAPLRRNRRDLVDSSGRLTLDDSLIYDNEGD
QVKNGTNMKSLNLEMQEPVVAASLSQTGASIGSALAAIMLLLLVFLVACFITRKCQKQRK
KPPTEDILEEYPLNTKVDVPKRSPDRLEKNMHRQYCTVRNVNILSETEGAYTFKGAKVKK
LNLEVRVHNNLQDGTEV
Download sequence
Identical sequences F6W7F3
ENSECAP00000006045 9796.ENSECAP00000006045 ENSECAP00000006045

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]