SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000006168 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000006168
Domain Number 1 Region: 218-362
Classification Level Classification E-value
Superfamily PH domain-like 1.26e-37
Family Third domain of FERM 0.0023
Further Details:      
 
Domain Number 2 Region: 115-220
Classification Level Classification E-value
Superfamily Second domain of FERM 7.2e-31
Family Second domain of FERM 0.0000778
Further Details:      
 
Domain Number 3 Region: 32-113
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.07e-26
Family First domain of FERM 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000006168   Gene: ENSECAG00000007878   Transcript: ENSECAT00000008260
Sequence length 597
Comment pep:known chromosome:EquCab2:23:8770830:9051307:1 gene:ENSECAG00000007878 transcript:ENSECAT00000008260 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFASCHCVPRGRRTMKMIHFRSSSIKSLSQEMKCTIRLLDDSEISCHIQRETKGQFLIDH
ICNYYSLLEKDYFGIRYVDPEKQRHWLEPNKSIFKQMKSHPPYTMCFRVKFYPHEPLKIK
EELTRYLLFLQIKRDIFHGRLLCSFSDAAYLGACIVQAELGDYDPDEHPENYISEFEIFP
KQSQKLERKIVEIHKNELRGQSPPVAEFNLLLKAHTLETYGVDPHPCKDSTGTTTFLGFT
AAGFVVFQGNKRIHLVKWPDVCKLKFEGKTFYVIGTQKEKKAMLAFHTSTPAACKHLWKC
GVENQAFYKYAKSSQIKTVSSSKIFFKGSRFRYSGKVAKEVVEASSKIQRDPPEVHRTNI
TQSRSSHSLNKQLIINMEPLQPLLPCPCEQEEELPLGEGVPLPKEDNISAPLISSSPVKE
AREYENPPREEEDKIREEPLTISELAYNPSASLLPTPVDDDEIDMLFDCPSRLELEREDT
DSFEDLEADENAFLMAEEEELKEAHQALSWSYDILSGHIRVNPLVKIFSRLLVVGLGLLL
FVFPLLLLLLESGIDLSFLCEIRQTPEFEQFHYEYYCPLKEWVAGKVNLILYMLGCS
Download sequence
Identical sequences F6UMY2
XP_001491783.1.31192 ENSECAP00000006168 ENSECAP00000006168 9796.ENSECAP00000006168

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]