SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000006188 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000006188
Domain Number 1 Region: 103-134
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000144
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 2 Region: 68-113,505-540
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000022
Family Growth factor receptor domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000006188   Gene: ENSECAG00000007865   Transcript: ENSECAT00000008282
Sequence length 547
Comment pep:known chromosome:EquCab2:21:26453374:26499328:1 gene:ENSECAG00000007865 transcript:ENSECAT00000008282 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAGRTFAFAICILEVSVLTAGPTPNYAPEPEQQSGTPLPIDCRMSSWSGWSECDPCLRQ
MFRSRSIEVFGQFNGQRCVDAVGDRRQCVPTEACEEVEDDCGNDFQCGTGRCIKKRLLCN
GDNDCGDFSDEDDCENDPRPPCRERVVEESELARTAGYGINILGMDPLSTPFDNEYYNGL
CDRVRDGNTLTYYRKPWNLASLAYETKADKNFRIEHYEQQIQAFRSVIEERRSHFNADFT
LKFTPTEAKKCKQEPEESCNGTDSSENRIFRFAYSKNETYQLFLSYSSKKEKMFLHVKGV
IQLGKFVMRSRDVVLTTTFLDDIKALPTAYEKGEYFAFLETYGTHYSSSGSLGGLYELIY
VLDKASMDQKGVELRDIQRCLGFNLDLSLKDKYEVTAKIDKNDCLKRNEKEIVNIMDGSL
IDDVISLIRGGTRKYAFELKEKLLKGAKTVNVTDFVNWASSLNDAPVLISQRLSPIYNLI
PVKMKDAHQKKQNLERAIEDYINEFSVRKCHPCQNGGTVIQMDGQCLCSCPIAFEGIACE
TGKKKIS
Download sequence
Identical sequences F6UFT2
XP_008524836.1.77740 9796.ENSECAP00000006188 ENSECAP00000006188 ENSECAP00000006188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]