SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000006236 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000006236
Domain Number 1 Region: 131-233
Classification Level Classification E-value
Superfamily SRCR-like 1.09e-45
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000523
Further Details:      
 
Domain Number 2 Region: 1-106
Classification Level Classification E-value
Superfamily SRCR-like 1.44e-40
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000006236   Gene: ENSECAG00000008256   Transcript: ENSECAT00000008340
Sequence length 233
Comment pep:known chromosome:EquCab2:1:10259976:10261290:-1 gene:ENSECAG00000008256 transcript:ENSECAT00000008340 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DLRLVNGGDPCQGRVEVLYRSWWGTVCDDDWDNNDANVVCRQLDCGRAMLAPGSAHFGEG
SGYIFLDDVRCSGYKSNLWSRAHNDWNSHNCGHHEDAGVICSEPLPTPASPRDPWPSQVC
LCSFPWTESGLALRLVNGGDRCQGRVEVLYRGSWGTVCDDDWDTNDANVVCRQLGCGWVT
SAPGSAHFGQGSGPIVLDDVRCSGQESYLWSCTHNGWNSHNCGHDEDAGVVCS
Download sequence
Identical sequences F6TJS5
9796.ENSECAP00000006236 ENSECAP00000006236 ENSECAP00000006236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]