SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000006283 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000006283
Domain Number 1 Region: 61-111
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000477
Family EGF-type module 0.0059
Further Details:      
 
Domain Number 2 Region: 19-54
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000559
Family EGF-type module 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000006283   Gene: ENSECAG00000008296   Transcript: ENSECAT00000008399
Sequence length 338
Comment pep:known chromosome:EquCab2:8:76435830:76471992:-1 gene:ENSECAG00000008296 transcript:ENSECAT00000008399 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RKKCCKGYKFVLGQCIPEDYDVCAEAPCEQQCTDNFGRVLCTCYPGYRYDRERHRKREKP
YCLDIDECATSNETLCAHICINTLGSYRCECREGYIQEDDGRTCTKGDKYPNDTGHEEKS
ENAVRAGTCCASCKEFHQMKQTVLQLKQKIALLPNSAAGLGKYVTGDKVLASNTYLPGPP
GLPGGQGPPGESGVQGGPTPAGEEGLRGYPNPTTSPAPAKVADDLVHQAEECRRVPVGPP
GAPGRDGSKGERGAPGPRGSPGPPGSFDFLLLMLADIRNDIAELQEKVFGHRTHSSAEEF
PSPQGSSSYPEAMGFGSGDDYPRRTETRDLGAPGDLYP
Download sequence
Identical sequences F6T4F6
ENSECAP00000006283 ENSECAP00000006283 9796.ENSECAP00000006283

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]