SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000006285 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000006285
Domain Number 1 Region: 78-170
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000068
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000006285   Gene: ENSECAG00000008204   Transcript: ENSECAT00000008402
Sequence length 188
Comment pep:known chromosome:EquCab2:5:28591918:28630924:1 gene:ENSECAG00000008204 transcript:ENSECAT00000008402 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLLLLLCFVLPSLVCAQQACSRGACYPPVGDLLIGRTRFLRASSTCGLTKPETYCTQYG
EWQMKCCKCDSRLPHNYNSHRVENVASSSGPMRWWQSKNDVSPVSLQLDLDKRFQLQDIV
MEFKAPMPAGMLIERSSDFGKTWRVYQYLAADCTSAFPRVRQGQPQSWQDVRCQSLPQRP
NGHLEGGK
Download sequence
Identical sequences F6T4E1
ENSECAP00000006285 ENSECAP00000006285 9796.ENSECAP00000006285

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]