SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

  Home > Genomes > Equus caballus 69_2 > ENSECAP00000006368

Domain assignment for ENSECAP00000006368 from Equus caballus 69_2

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:  ENSECAP00000006368
Domain Number 1 Region: 423-683
Classification Level Classification E-value
Superfamily YWTD domain 4.19e-56
Family YWTD domain 0.0000000194
Further Details:      
 
Domain Number 2 Region: 251-292
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000772
Family LDL receptor-like module 0.00074
Further Details:      
 
Domain Number 3 Region: 125-160
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000406
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 4 Region: 5-41
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000654
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 5 Region: 219-253
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000113
Family LDL receptor-like module 0.00067
Further Details:      
 
Domain Number 6 Region: 40-81
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000144
Family LDL receptor-like module 0.00078
Further Details:      
 
Domain Number 7 Region: 78-123
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000602
Family LDL receptor-like module 0.00063
Further Details:      
 
Domain Number 8 Region: 339-382
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000234
Family EGF-type module 0.0028
Further Details:      
 
Domain Number 9 Region: 164-199
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000353
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 10 Region: 375-414
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000765
Family EGF-type module 0.0013
Further Details:      
 
Domain Number 11 Region: 297-332
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000223
Family LDL receptor-like module 0.0005
Further Details:      
 
Domain Number 12 Region: 694-734
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000266
Family EGF-type module 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000006368   Gene: ENSECAG00000007244   Transcript: ENSECAT00000008494
Sequence length 962
Comment pep:known chromosome:EquCab2:2:6064723:6140856:1 gene:ENSECAG00000007244 transcript:ENSECAT00000008494 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence 
GSVKECEENQFRCRNERCIPSVWRCDEDDDCSDNSDEDDCPKKTCADSDFTCDDGHCIPE
RWRCDGEEECPDGSDESEATCTKQVCPAEKLSCGPTSHKCVPASWRCDGEKDCESGADEA
GCATLCAPHEFQCSNRSCLAAVFVCDGDDDCGDGSDERGCADPACGPREFRCGGDDGACI
PERWVCDRQFDCEDRADEAAELCGRTGPGPTPAPAACAAAAQFACRSGECVHLGWRCDGD
RDCKDKSDEADCPLGTCRGDEFQCGDGTCVPAVKRCNQEQDCPDGSDEAGCLQESPCEGP
RRFQCKSGECVDGRKVCDAQRDCRDWSDEPLKECGLNECLHNNGGCSHICTDLKIGFECT
CPAGYRLLDQKTCGDIDECEDPDTCSQICVNYKGYFKCECHPGYEMDTLTKNCKAVAGRS
PSLIFTNRHEVRRIDLVKRDYSRLIPMLKNVVALDVEVATNRIYWCDLSYRKIYSAYMDK
ASDPAEQEVLIDEQLHSPEGLAVDWVHKHIYWTDSGNKTISVATVDGGRRHTLFSRDLSE
PRAIAVDPLQGFMYWSDWGYQAKIEKSGLNGADRQTLVSDNIEWPNGITLDLLNQRLYWV
DSKLHQLSSIDFSGGNRKMLISSPDFLSHPFGIAVFEDKVFWTDLENEAIFSANRLNGLE
ISVLAENLNNPHDIVIFHELKQPRAADACELSAQPNGGCEYLCLPAPQLSGHSPKYTCAC
PDTMWLGPDMKRCYRAPQSTSTTTLASTTTRTVADTTGAPGTTIHSPTNQNHSTETPSLA
AAVPSSVSVPRAPSISPSTPSPATSNHSQHYGNEGGKMDSTVTAAVIGIIVPMAVIALLC
MSGYLIWRNWKRKNTKSMNFDNPVYRKTTEEEDEDELHIGRTAQIGHVYPAAISSFDHPL
WAEPCLGETRELEDPAPALKELFVLPGEPRSQLHQLPKNPLSELPVVKCKRVALSLEDDG
LP
Download sequence
Identical sequences F6VAY2
ENSECAP00000006368 9796.ENSECAP00000006368 ENSECAP00000006368

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]
Please cite: Gough, J., Karplus, K., Hughey, R. and Chothia, C. (2001). "Assignment of Homology to Genome Sequences using a Library of Hidden Markov Models that Represent all Proteins of Known Structure." J. Mol. Biol., 313(4), 903-919.

Please send feedback, comments or questions to superfamily@cs.bris.ac.uk or use the feedback form.

© Copyright 2013 The SUPERFAMILY authors and Julian Gough.