SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000006461 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000006461
Domain Number 1 Region: 110-358
Classification Level Classification E-value
Superfamily vWA-like 1.22e-81
Family Integrin A (or I) domain 0.0000000194
Further Details:      
 
Domain Number 2 Region: 354-444
Classification Level Classification E-value
Superfamily Integrin domains 4.71e-31
Family Integrin domains 0.000087
Further Details:      
 
Domain Number 3 Region: 610-693
Classification Level Classification E-value
Superfamily Integrin beta tail domain 6.93e-20
Family Integrin beta tail domain 0.00035
Further Details:      
 
Domain Number 4 Region: 3-55
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000262
Family Plexin repeat 0.00061
Further Details:      
 
Domain Number 5 Region: 569-609
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000586
Family Integrin beta EGF-like domains 0.0025
Further Details:      
 
Domain Number 6 Region: 526-564
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000502
Family Integrin beta EGF-like domains 0.013
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000006461
Domain Number - Region: 495-526
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0276
Family Integrin beta EGF-like domains 0.033
Further Details:      
 
Domain Number - Region: 452-478
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0614
Family Integrin beta EGF-like domains 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000006461   Gene: ENSECAG00000007589   Transcript: ENSECAT00000008607
Sequence length 777
Comment pep:known chromosome:EquCab2:19:34779832:34876324:1 gene:ENSECAG00000007589 transcript:ENSECAT00000008607 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLNICTSGSATSCEECLLIHPKCAWCSKEDFGSPRSVTSRCDLKANLIKNGCGGEFESPA
SSTQVLRSLPLSSKGSSSAGSDVIQMTPQEIAVNLRPGDKTAFQLQVRQVEDYPVDLYYL
MDLSLSMKDDLDSIRNLGTKLAEEMRKLTSNFRLGFGSFVDKNISPFSYTAPRYQTNPCI
GYKLFPNCVPSFGFRHLLPLTDRVDSFNEEVRKQRVSRNRDAPEGGFDAVLQAAVCKEKI
GWRKDALHLLVFTTDDVPHIALDGKLGGLVQPHDGQCHLNEANEYTASSQMDYPSLALLG
EKLAENNINLIFAVTKNHYMLYKNFTALIPGTTVEILYGDSKNIIQLIINAYNSIRSKVE
LSVWDQPEDLNLVFTATCQDGVSYPGQRKCEGLKIGDTASFEVSVEARSCPGRHAEHTFT
LRPVGFRDSLEVGVTYNCKCGCSAGREPASSRCSGNGTYVCGLCECNPSYLGTRCECQEG
ESPSGYQNLCREAEGKPLCSGRGECSCNQCSCFESEFGKIYGPFCECDNFSCARNKGVLC
SGHGECHCGECKCHAGYIGDNCNCSTDISTCQAKDGQICSDRGHCVCGQCQCTEPGAFGE
TCEKCPTCPDACSTKRDCVECLLLHSGSPADNQTCQSLCKDEVITRVDTIVKDDQEAVLC
FYKTAKDCVMMFTYAELPSGKSNLTVLREPECGTAPNAMTILLAVVGSILLIGIALLAIW
KLLVTIHDRREFAKFQSERSRARYEMASNPLYRKPISTHTVDFTFNKFNKSYNGTVD
Download sequence
Identical sequences F6TXW5
ENSECAP00000006461 9796.ENSECAP00000006461 ENSECAP00000006461

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]