SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000006481 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000006481
Domain Number 1 Region: 4869-5084
Classification Level Classification E-value
Superfamily GFP-like 3.56e-63
Family Domain G2 of nidogen-1 0.00074
Further Details:      
 
Domain Number 2 Region: 2473-2572
Classification Level Classification E-value
Superfamily Immunoglobulin 7.55e-26
Family I set domains 0.014
Further Details:      
 
Domain Number 3 Region: 3240-3341
Classification Level Classification E-value
Superfamily Immunoglobulin 2.66e-24
Family I set domains 0.0051
Further Details:      
 
Domain Number 4 Region: 2392-2480
Classification Level Classification E-value
Superfamily Immunoglobulin 8.73e-24
Family I set domains 0.017
Further Details:      
 
Domain Number 5 Region: 4073-4170
Classification Level Classification E-value
Superfamily Immunoglobulin 8.81e-24
Family I set domains 0.017
Further Details:      
 
Domain Number 6 Region: 2958-3057
Classification Level Classification E-value
Superfamily Immunoglobulin 1.24e-23
Family I set domains 0.0058
Further Details:      
 
Domain Number 7 Region: 1163-1260
Classification Level Classification E-value
Superfamily Immunoglobulin 1.39e-23
Family I set domains 0.011
Further Details:      
 
Domain Number 8 Region: 603-699
Classification Level Classification E-value
Superfamily Immunoglobulin 4.22e-23
Family I set domains 0.02
Further Details:      
 
Domain Number 9 Region: 2581-2668
Classification Level Classification E-value
Superfamily Immunoglobulin 5.49e-23
Family I set domains 0.0098
Further Details:      
 
Domain Number 10 Region: 3711-3807
Classification Level Classification E-value
Superfamily Immunoglobulin 9.37e-23
Family I set domains 0.018
Further Details:      
 
Domain Number 11 Region: 3627-3718
Classification Level Classification E-value
Superfamily Immunoglobulin 1e-22
Family I set domains 0.008
Further Details:      
 
Domain Number 12 Region: 2297-2386
Classification Level Classification E-value
Superfamily Immunoglobulin 1.8e-22
Family I set domains 0.015
Further Details:      
 
Domain Number 13 Region: 3051-3152
Classification Level Classification E-value
Superfamily Immunoglobulin 1.96e-22
Family I set domains 0.0071
Further Details:      
 
Domain Number 14 Region: 1085-1176
Classification Level Classification E-value
Superfamily Immunoglobulin 2.08e-22
Family I set domains 0.015
Further Details:      
 
Domain Number 15 Region: 4429-4526
Classification Level Classification E-value
Superfamily Immunoglobulin 2.52e-22
Family I set domains 0.012
Further Details:      
 
Domain Number 16 Region: 2788-2870
Classification Level Classification E-value
Superfamily Immunoglobulin 2.82e-22
Family I set domains 0.029
Further Details:      
 
Domain Number 17 Region: 1820-1919
Classification Level Classification E-value
Superfamily Immunoglobulin 3.12e-22
Family I set domains 0.0079
Further Details:      
 
Domain Number 18 Region: 791-883
Classification Level Classification E-value
Superfamily Immunoglobulin 3.8e-22
Family I set domains 0.015
Further Details:      
 
Domain Number 19 Region: 3799-3898
Classification Level Classification E-value
Superfamily Immunoglobulin 6.57e-22
Family I set domains 0.0061
Further Details:      
 
Domain Number 20 Region: 4346-4445
Classification Level Classification E-value
Superfamily Immunoglobulin 6.72e-22
Family I set domains 0.012
Further Details:      
 
Domain Number 21 Region: 4163-4261
Classification Level Classification E-value
Superfamily Immunoglobulin 8.66e-22
Family I set domains 0.021
Further Details:      
 
Domain Number 22 Region: 2878-2965
Classification Level Classification E-value
Superfamily Immunoglobulin 9e-22
Family I set domains 0.0044
Further Details:      
 
Domain Number 23 Region: 3146-3245
Classification Level Classification E-value
Superfamily Immunoglobulin 9.96e-22
Family I set domains 0.0067
Further Details:      
 
Domain Number 24 Region: 888-982
Classification Level Classification E-value
Superfamily Immunoglobulin 1e-21
Family I set domains 0.0089
Further Details:      
 
Domain Number 25 Region: 1743-1827
Classification Level Classification E-value
Superfamily Immunoglobulin 1.03e-21
Family I set domains 0.018
Further Details:      
 
Domain Number 26 Region: 2679-2767
Classification Level Classification E-value
Superfamily Immunoglobulin 1.2e-21
Family I set domains 0.012
Further Details:      
 
Domain Number 27 Region: 3978-4077
Classification Level Classification E-value
Superfamily Immunoglobulin 1.82e-21
Family I set domains 0.037
Further Details:      
 
Domain Number 28 Region: 42-218
Classification Level Classification E-value
Superfamily vWA-like 1.95e-21
Family Integrin A (or I) domain 0.025
Further Details:      
 
Domain Number 29 Region: 3894-3991
Classification Level Classification E-value
Superfamily Immunoglobulin 2.24e-21
Family I set domains 0.028
Further Details:      
 
Domain Number 30 Region: 518-618
Classification Level Classification E-value
Superfamily Immunoglobulin 3.34e-21
Family I set domains 0.044
Further Details:      
 
Domain Number 31 Region: 3442-3528
Classification Level Classification E-value
Superfamily Immunoglobulin 4.31e-21
Family I set domains 0.016
Further Details:      
 
Domain Number 32 Region: 1446-1547
Classification Level Classification E-value
Superfamily Immunoglobulin 5.77e-21
Family I set domains 0.02
Further Details:      
 
Domain Number 33 Region: 1555-1640
Classification Level Classification E-value
Superfamily Immunoglobulin 1.41e-20
Family I set domains 0.014
Further Details:      
 
Domain Number 34 Region: 2102-2196
Classification Level Classification E-value
Superfamily Immunoglobulin 1.69e-20
Family I set domains 0.013
Further Details:      
 
Domain Number 35 Region: 3349-3434
Classification Level Classification E-value
Superfamily Immunoglobulin 3.96e-20
Family I set domains 0.011
Further Details:      
 
Domain Number 36 Region: 4250-4347
Classification Level Classification E-value
Superfamily Immunoglobulin 7.94e-20
Family I set domains 0.013
Further Details:      
 
Domain Number 37 Region: 2007-2105
Classification Level Classification E-value
Superfamily Immunoglobulin 1.23e-19
Family I set domains 0.0074
Further Details:      
 
Domain Number 38 Region: 1917-2013
Classification Level Classification E-value
Superfamily Immunoglobulin 1.55e-19
Family I set domains 0.02
Further Details:      
 
Domain Number 39 Region: 1633-1733
Classification Level Classification E-value
Superfamily Immunoglobulin 1.72e-19
Family I set domains 0.0049
Further Details:      
 
Domain Number 40 Region: 3536-3621
Classification Level Classification E-value
Superfamily Immunoglobulin 2.23e-19
Family I set domains 0.025
Further Details:      
 
Domain Number 41 Region: 1365-1454
Classification Level Classification E-value
Superfamily Immunoglobulin 2.48e-19
Family I set domains 0.013
Further Details:      
 
Domain Number 42 Region: 701-798
Classification Level Classification E-value
Superfamily Immunoglobulin 3.8e-19
Family I set domains 0.02
Further Details:      
 
Domain Number 43 Region: 1277-1360
Classification Level Classification E-value
Superfamily Immunoglobulin 8.09e-19
Family I set domains 0.0052
Further Details:      
 
Domain Number 44 Region: 2190-2291
Classification Level Classification E-value
Superfamily Immunoglobulin 1.44e-18
Family I set domains 0.011
Further Details:      
 
Domain Number 45 Region: 980-1073
Classification Level Classification E-value
Superfamily Immunoglobulin 3.12e-17
Family I set domains 0.0085
Further Details:      
 
Domain Number 46 Region: 5090-5233
Classification Level Classification E-value
Superfamily Growth factor receptor domain 5.49e-17
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 47 Region: 4638-4696
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000275
Family TSP-1 type 1 repeat 0.00017
Further Details:      
 
Domain Number 48 Region: 4582-4639
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000458
Family TSP-1 type 1 repeat 0.00031
Further Details:      
 
Domain Number 49 Region: 4527-4578
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000732
Family TSP-1 type 1 repeat 0.00035
Further Details:      
 
Domain Number 50 Region: 4810-4867
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000102
Family TSP-1 type 1 repeat 0.00025
Further Details:      
 
Domain Number 51 Region: 4696-4753
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000144
Family TSP-1 type 1 repeat 0.00026
Further Details:      
 
Domain Number 52 Region: 4752-4810
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000353
Family TSP-1 type 1 repeat 0.00029
Further Details:      
 
Domain Number 53 Region: 5199-5271,5298-5353
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000518
Family Growth factor receptor domain 0.009
Further Details:      
 
Domain Number 54 Region: 5410-5526
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000188
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 55 Region: 448-521
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000386
Family I set domains 0.029
Further Details:      
 
Domain Number 56 Region: 5269-5306
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000014
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000006481   Gene: ENSECAG00000007173   Transcript: ENSECAT00000008627
Sequence length 5634
Comment pep:known chromosome:EquCab2:5:22378436:22815739:1 gene:ENSECAG00000007173 transcript:ENSECAT00000008627 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MISWDMVHTVFLFALLYSSLAQDASSQSEIRAEEIPEGASTLAFVFDVTGSMYDDLVQVI
EGASKILETSLKRPKRPLFNFALVPFHDPEIGPVTITTDPKKFQYELRELYVQGGGDCPE
MSIGAIKIALEISLPGSFIYVFTDARSKDYRLTHEVLQLIQQKQSQVVFVLTGDCDDRSH
IGYKVYEEIASTSSGQVFHLDKKQVNEVLKWVEEAVQSSKVHLLSTDHLQEAVNTWKIPF
DPSLKEVTVSLSGPSPAIEIRNPLGKLIKKGFGLNELLNIQNSAKVVNVKEPEAGMWTVK
TSSSGRHSVRITGLSTIDFRAGFSRKPTLDFKKTVSRPVQGIPTYVLLNTSGISIPARVD
RLELLSISGSSLKTIPVKYYPDRKPYGIWNISDFIPPSEAFFLKVTGYDKDDYLFQRVSS
VSFSSIVPDAPKVTMPRKTPGYYLQPGRIPCSVESLLPFTLSFVRNGVTLGVDQYLKESA
SVNWDIEKVTLSDEGSYECIAVSSAGTGRAQTFFDVSEPPPVIQVPNNVTVTPGERTVLT
CLVISAVDYNLTWQRNDRDVSLADPARMRILANLSLELRSVKFSDAGEYHCVVSNEGGSS
AASVFLTVQEPPKVTVMPKNQSFTAGSEVSIMCSATGYPKPKIAWTINDMFIVGSHRYRM
TSEGTLFIKNAVPKDAGIYGCLASNTAGTDKQTSTLRYYSPKLIVVQSELLVALGDTTVL
ECKTSGVPPPHVKWFKGDLELRPSTFLIIEPLLGLLKIQETQDLDAGDYTCVAVNDAGRA
TGKITLDVGSPPVFIQEPIDVSVEIGSNVTLPCYVQGYPEPKIKWQRLDNMPIFSRPFSV
SSISQLRTGALFISNLWASDKGTYICEAENQFGKIQSQATITVTGLVAPLIGISPSVTSV
IEGQQLTLPCALLAGNPIPERRWVKNSAMLVQNPYITVRSDGSLHIERVRLQDEGKYTCV
ASNVAGTINKTTTVDVHVLPTIQHGQQILSTIEGIPVTLPCKASGIPKPSIIWSKKGELI
STSSAKFSAGADGSLYVVSPGGEESGEYVCTATNAAGYAKRKVQLTVYVRPRVFGDQRGL
SQDKPVEISVLAGEEVTLPCEVKSLPPPIITWAKETQLISPFSPRHTFLPSGSMKITEAR
VSDTGMYLCVATNIAGNVTQSVKLNVHVPPKIQRGPKLMKVQVGQRVGLPCSAEGTPLPV
ITWFKGRSTVLVDGVQHISSPDGTLSINQAMLSDTGVYTCVATNIAGSDETEITLHVQEP
PTLEAPEPPYNTPFQERVVSQRIAFPCPAKGTPKPTIKWLWNGKELTGREPGISILDDGT
LLVIASVTPYDNGEYICVAVNEAGTTERKYNLKVHVPPVMKDKEQITNVSVLVNQLTNLF
CEVEGTPSPIIMWYKDDVQVTESSSMQIVNNGKVLKLFKATPEVAGRYSCKAINIAGTSQ
KYFNIDVLVPPTIIGASSPNEVSVVLNHDTTLECQVKGTPFPIIHWFKDGKPLFLGDPNI
ELLDRGQVLRLKNARRSDKGRYQCAVSNAAGKQAKDIKLTIYIPPSIKGGNVTTEISALI
NSIIKLECETRGLPMPAITWYKDGQPVISSSQALYIDKGQFLHIPRAQVSDSATYTCHVT
NVAGTAEKSFHVDVYVPPMIEADLALPLNKQVVVAHSLTLECKAAGNPPPVLTWLKDGVP
VKASDNIRIEAGGKKLEIMSALEVDRGQYVCVATSVAGEKELIYEVDVLVPPAVEGGGET
SYFIVMVNSLLELECQVTGSPPPTIMWLKDGQLIDERDEFKILLNGRKLVIAQAQVSDTG
LYRCVATNTAGDGKKEFEVTVHVPPTIKSSGLSERAVVKYKPVTLQCIANGIPHPSITWL
KDGQPVNTAQGNLKIQSSGRVLQIAKALMEDAGRYTCVATNAAGEGQQHIQLHVHEPPSL
EDAGKMLNETVVVSNPIQLECKAAGNPLPAVTWYKDNRPLSGSASVTFLNRGQIIDIESA
KIADAGIYKCVAINSAGATELFYSLQVHVPPSISGSNNMVAVVVNNLVRLECEARGIPAP
SLTWLKDGSPVSSFANGIQVLSGGRILALTSAQISDTGRYTCVAVNAAGEKQRDIDLRVY
VAPNIMGEEQNISVLINQAVELLCQSDAIPPPTLTWLKDGRLLLKKPGLSISENGSMLKI
VDAQVQDTGRYTCEATNVAGKTEKNYNVNIWVPPNIYSSDELTQLTVIEGNLISLLCESS
GIPPPNLIWKKKGSPVLADSAGRVRTLSGGRLLQISIAEKSDAGLYACVASNVAGTAKKD
YKLQVYIRPTISNSGSHPTEIIVTRGKSISLECEVQGIPQPTVTWMKDGRPLTKGRGMEI
MDEGRVLQLKNIHVSDTGRYVCVAMNVAGMTDRKYDLSVHTPPSIIGNHETPENISVVEK
NSVSLTCEASGIPLPSITWLKDGWPVSLSSSVRILSGGRTLRLMQTRIEDAGQYTCVVRN
AAGEERKIFGLSVLVPPRIVGENTWEDVKVKEKQSVTLTCEVTGNPVPEITWHKDGQLLQ
EDDTHHIMSGGRFLQITNAQVSHTGRYICLASNTAGDKSKSFSLNVLVSPTIAGVDGNGS
PEDVTVILNSPTSLVCEAYSYPPATITWFKDGTALESNRNIRILPGGRTLQILNAQEDNA
GRYSCVATNEAGEMIKHYEVKVYIPPIINKGDLLGPGLSPKEVKIRVNNTLTLECEAYAI
PSASLSWYKDGPPLKSDDHVNIAASGHTLQIKEAQISDTGRYTCVASNLAGEDELDFDVN
IQVPPSFQKLWEIGNMLDTGRSGEAKDVIINNPISLYCETNAAPPPTLTWYKDGRPLTSS
DRILILPGGRVLQIPRARVEDAGRYTCVAVNEAGEDSLQYDVRVLLPPSIKGASSDLPEE
VTVLVNQSVLMECISSGSPAPRNSWQKDGQPLLEDEHHKFLSNGRILQILNIQITSIGRY
VCIAENTAGSAKKYFNLNVHVPPSVLGPNPENLTVVVNHFISLTCEVSGFPPPDLSWLKN
EQPIKLNTNALIVPGGRTLQIIRAKVSDGGEYTCIAINQAGERKKKVFLTVYVPPSIKDQ
GSDSLSVVNVREGTPVSLACESNAVPPPVITWYKNGRMITESTHSEILADGQMLYIQKAE
VSDTGQYVCRAINVAGRDDKNFHLNVYVPPSIEGPEKEVVVETISNPVTLTCDATGIPPP
TIAWVKNHKPIENSDSLEVHILSGGRKLQIARSQRSDSGNYTCIASNMEGKAQKSYSLSI
LVPPSVAGAEIPSEVSVLLGENVELVCNANGIPTPLIQWLRDGKPVTGSETERIRVTANG
STLNIYGALPSDMGKYTCVATNPAGEEDRIFNLNVYVPPAIRGNKEEAEKLMALVDTSIN
IECRATGIPPPQINWLKNGLPLPLSSHIRLLSGGQVIRIVRAQVSDVAMYTCVASNRAGV
DNKHYNLQVFVPPNLDNAMGTEEITIVKGSSTSMTCFTDGTPTPRMSWLRDGQPLGLDAH
LTVSTQGMVLQLVKAETEDSGRYTCIASNEAGEVSKHFILKVLEPPHINGSEEAVEISVI
VNNPLELTCIASGIPAPKITWMKDGRPLPQMDQVQTLGGGEVLRIASAQVEDTGRYTCLA
SSPAGDDDKEYLVRIHVPPNIAGTDESRDFTVLRNRQMTLECKSDAVPPPVITWLKNGER
LQATPRVRILSGGRYLQINNADLGDTANYTCVASNIAGKTTREFILTVNAPPNIRSGPQS
LVIHLNKSAVLECFAEGVPTPRITWRKDGAVLSGSHVRYSILENGFLHIQSAHVTDTGRY
LCMATNAAGTDRKRIDLQVHVPPSIALGPTNITVTVNVQTTLACEATGIPKPSINWRKNG
HLLNVDQNQNSYRLLSSGSLVIISPSVDDTATYECTVTNDAGEDKRTVDLTVQVPPSIAD
EPTDFLVTKHAPTVISCTASGVPFPSIHWMKNGIRLLPRGDGYRILSSGAIEIFATQLNH
AGRYTCVARNAAGSAHRHVTLHVQEPPAIQPQPSELDVILNNPILLPCQATGTPSPFITW
QKEGINVIASGKSHAVLPSGGLQISRAVREDAGTYMCVAQNPAGTALGKIKLNVQVPPVI
SPHPKEYIIVVDKPIMLPCEADGLPPPDITWHKDGHAIMESIRQRILSSGALQIAFAQPD
DTGQYTCMAANVAGSSSTSTRLTVHVPPRIRNTEVHYTVNENSQAVLSCLADGIPTPSIN
WKKDNVLLANLLGKYTVEPYGELILESVVPEDSGTYTCVANNAAGEDAHTVSLTVHVLPT
FTELPGDASLNKGEQLRLNCKATGIPLPKLTWTFNNNIIPAHFDSVNGHSELVIERVSKE
DSGTYVCTAENTVGFVKAIGFVYVKEPPVFKGDYPSNWIEPLGGNAILNCEVKGDPAPTI
QWSRRGMDIEISHRIRQLGNGSLAIYGTVNEDAGDYTCVAANEAGVVERSMSLTLQSPPI
ITLEPVETVTNVGGKVTLNCQATGEPHPTITWSRQGHSIPWDDRVRMLSNNSLYITAAQK
EDTSEYECVARNLMGSVLVRVPVTVQVNGGFSQWSAWRSCSVTCGKGIQKRSRLCNSPFP
ANGGKPCQGLDSEMRNCQHKLCPVDGSWSEWSPWEECTRSCGRGNRTKTRTCNNPSAQNG
GRPCEGNAVEIIMCNIRPCPVHGAWNTWQPWGICSKSCGKGTQTRTRLCNNPPPSFDGSY
CEGAETQMQVCNERHCPVDGRWATWASWSACTVSCGGGARQRTRDCSDPVPQYGGNRCEG
SDVQSDFCNSDPCPTHGNWSPWSGWGICSRTCNGGQMRRYRTCDNPRPSNGGRACGGPDS
QMQRCNTEMCPVDGSWGNWHSWSRCSASCGGGEKTRKRLCNTPVPSKSGRPCPGDATQVS
RCNIQACPGGPQRAKGSVIGNINDVEFGIAFLNATVTDSPTSDTRIIHAKITNVPRSLGT
AMRKIVSILNPIYWTTAKEIGEAVNGFTLTNAVFKRETQVEFATGEILRMTHIARGLDSD
GSLLLDIVVSGYVLQLQSPTEVTVKDYTEDYVQTGPGQLYAYSTRLFTIDGISVPYTWNH
TVLYDQARGRMPFLVETLHASSVESDYNQLEETLGFKIHASISKGDRSNQCPSGFALDSV
GPFCADEDECAAGSPCSHVCHNAVGTYYCSCPKGLTIAPDGRTCQDIDECALGGHTCHAG
QDCDNTIGSYRCVVRCGIGFRRTSDGLSCQDINECQESSPCHHRCFNAIGSFHCGCEPGY
QLKGRKCLDVNECRQSVCRPDQHCKNTRGGYKCIDLCPNGMTKAENGTCIDIDECKDGTH
QCRYNQICENTRGSYRCVCPRGYRSQGVGRPCLDINECEQVHKPCAYQCSNTPGSFKCIC
PPGQHLLGDGKSCAGLERLPNYGTQYHSYNLARFSPVRNNYQPQQHYRQYSHLYSAYSEY
RNSRTSLSRTRRTIRKTCPEGCEASHDRCVDIDECENRDTCQHECKNTFGSYQCICPPGY
QLMLNGKTCQDVDECLEQNVRCGPNHMCFNMRGSYQCIDTPCPPNYQRDPVSGFCLKNCP
PNDLECALSPYALEYKLVSLPFGIAANQDLIRLVAYTQDGVMHPRTTFLMVHEEQTVPFA
LRDENLKGVVYTTRPLREPETYRMRVRALSYSANGTIDYQTTFIVYIAVSAYPY
Download sequence
Identical sequences F6TQY1
ENSECAP00000006481 ENSECAP00000006481 9796.ENSECAP00000006481

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]