SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000006489 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000006489
Domain Number 1 Region: 20-217
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.74e-61
Family Calnexin/calreticulin 0.0000552
Further Details:      
 
Domain Number 2 Region: 201-315
Classification Level Classification E-value
Superfamily P-domain of calnexin/calreticulin 1.07e-45
Family P-domain of calnexin/calreticulin 0.000000573
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000006489
Domain Number - Region: 308-348
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0222
Family Calnexin/calreticulin 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000006489   Gene: ENSECAG00000008164   Transcript: ENSECAT00000008636
Sequence length 412
Comment pep:known chromosome:EquCab2:7:45483000:45486353:-1 gene:ENSECAG00000008164 transcript:ENSECAT00000008636 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLPAPLLLGLLGLVAAEPAIYFKEQFLDGDGWAERWIESKHKSDFGKFILSSGKFYGDQ
EKDKGLQTSQDARFYALSARFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPDSLDQT
DMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDN
TYEVKIDNSQVESGSLEDDWDFLPPKKIKDPNAAKPEDWDERAKIDDPTDSKPEDWDKPE
HIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYS
PDGNIYAYENFAVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDK
QDEEQRLKEEEEDKKRKEEEEADKDDEDDKEEDEEDEEDEEEDAAGQAKDEL
Download sequence
Identical sequences F6TQR2
ENSECAP00000006489 ENSECAP00000006489 XP_001504932.1.31192 9796.ENSECAP00000006489

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]