SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000006527 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000006527
Domain Number 1 Region: 29-154,186-551
Classification Level Classification E-value
Superfamily Sema domain 5.1e-177
Family Sema domain 0.0000000000577
Further Details:      
 
Domain Number 2 Region: 613-696
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000303
Family I set domains 0.042
Further Details:      
 
Domain Number 3 Region: 547-598
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000314
Family Plexin repeat 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000006527   Gene: ENSECAG00000007709   Transcript: ENSECAT00000008682
Sequence length 785
Comment pep:known chromosome:EquCab2:16:37054572:37083266:-1 gene:ENSECAG00000007709 transcript:ENSECAT00000008682 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVAGLLLWASLLTGAWPATLTQDHLPATPRVRLSFKELKATGTAHFFNFLLNTTDYRIL
LKDEDHDRMYVGSKDYVLSLDLHDINREPLIIHWAASPQRIEECVLSGKDGNGECGNFVR
LIQPWNRTHLYVCGTGAYNPMCTYVNRGRRAQAMSWTQMQVVRGRGNRATDGTFRLTPTA
PRQDYIFYLEPERLESGKGKCPYDPKLDTASALINEELYAGVYIDFMGTDAAIFRTLGKQ
TAMRTDQYNSRWLNEPSFIHAELVPDSAERNDDKLYFFFRERSAEAPQSPAVYARIGRIC
LNDDGGHCCLVNKWSTFLKARLVCSVPGEDGIETHFDELQDVFVQQTQDVRNPVIYAVFT
SSGSVFRGSAVCVYSMADIRMVFNGPFAHKEGPNYQWMPFSGKMPYPRPGTCPGGTFTPS
MKSTKDYPDEVINFMRSHPLMYQAVYPLQRRPLVVRTGAPYRLTTVAVDQVDAADGRYEV
LFLGTDRGTVQKVIVLPKDDQEMEELMLEEVEVFKDPAPVKTMTISSKRQQLYVASAVGV
THLSLHRCQAYGAACADCCLARDPYCAWDGQACSRYTASSKRRSRRQDVRHGNPIRQCRG
FNSNANKNAVESVQYGVAGSAAFLECQPRSPQATVKWLFQRDPSDRRREIRAEDRFLRTE
QGLLLRALQLGDRGLYSCTATENNFKHVVTRVQLHVLGRDAVHAALFPPPAVSAPPPAGA
GLPTPPYQELAQLLAQPEVGLIHQYCQGYWRHVPPSPRDAPGAPRPPEPQDQKKPRNRRH
HPPDT
Download sequence
Identical sequences F6WAB7
9796.ENSECAP00000006527 ENSECAP00000006527 ENSECAP00000006527 XP_001496563.1.31192 XP_008528016.1.77740

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]