SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000006597 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000006597
Domain Number 1 Region: 637-910
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 5.9e-100
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000579
Further Details:      
 
Domain Number 2 Region: 215-361
Classification Level Classification E-value
Superfamily PH domain-like 1.2e-34
Family Third domain of FERM 0.00017
Further Details:      
 
Domain Number 3 Region: 112-217
Classification Level Classification E-value
Superfamily Second domain of FERM 5.1e-33
Family Second domain of FERM 0.0002
Further Details:      
 
Domain Number 4 Region: 27-112
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.21e-20
Family First domain of FERM 0.0022
Further Details:      
 
Domain Number 5 Region: 516-605
Classification Level Classification E-value
Superfamily PDZ domain-like 1.01e-19
Family PDZ domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000006597   Gene: ENSECAG00000007806   Transcript: ENSECAT00000008763
Sequence length 921
Comment pep:known chromosome:EquCab2:25:14711559:14783174:-1 gene:ENSECAG00000007806 transcript:ENSECAT00000008763 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSRLRALGGRINNIRTSELPKEKTRSEVICSICFLDGLVQTFKVNKQDTGQVLLDMVYN
HLGVTEKEYFGLQHGDDSVDSPRWLESSKPIRKQLKGGFPCTLHFRVRFFIPDPNTLQQE
QTRHLYFLQLKMDICEGRLTCPLNSAVVLASYAVQSHFGDYNSSIHHPGYLSDSQFIPDQ
SDDFVTKVESLHKQHSGLKQSEAESCYINIARTLDFYGVELHGGRDLHSLDLMIGIASSG
IAVYRKYICTSFYPWVNILKISFKRKKFFIHQRQKQTESREHIVAFNMLNYRSCKNLWKS
CVEHHSFFQAKKLLPQEKNVLSQYWTLGSRNSKKSVNNQCCKKVIGGMVWNPAMRRSLSV
EHLETKSLPSRSPPITPNWRSPRLRHEIRKPRHSSADNLANEMTYITETEDVFYTYKGSL
SPKDSDSEVSQNRSPHRNGGEMDSVQSVSENNPAHSCLTRKSSSSVSPSSNAPGSCSPDG
VDQQFLEDFHRVTKGGSSEDSSQYYCDKNDNGDGYLVLIRITPDEDGKFGFNLKGGVDQK
MPLVVSRINPESPADTCIPKLNEGDQIVLINGRDISEHTHDQVVMFIKASRESHTRELAL
VIRRKAVHSFADIKSEDELNELFPEAIFPVCPEGGDTLEGSMEQLKKGLESGTVLIQFEQ
LYRKKPGLAITFAKLPQNLDKNRYKDVLPYDTTRVLLQGNEDYINASSVNMEIPPAHLVN
KYIATQGPLPHTCAQFWQVIWDQKLSLIVMLTTLTERGRTKCHQYWPDPPDVMEYGSFHI
RCQSEDCTIAYVFREMLVTNTETGEEHTVTHLQYVAWPDHGVPDDPSDFLEFVNYVRSLR
VDGEPVLVHCSAGIGRTGVLVTMETAMCLIERNLPVYPLDIVRKMRDQRAMMVQTSSQYK
FVCEAILRVYEEGLVPMLDPS
Download sequence
Identical sequences F6VP79
ENSECAP00000006597 ENSECAP00000006597 9796.ENSECAP00000006597

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]