SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000006603 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000006603
Domain Number 1 Region: 136-264
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.62e-24
Family Synaptotagmin-like (S variant) 0.021
Further Details:      
 
Domain Number 2 Region: 297-484
Classification Level Classification E-value
Superfamily vWA-like 2.47e-17
Family Integrin A (or I) domain 0.014
Further Details:      
 
Domain Number 3 Region: 18-137
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 7.86e-16
Family Synaptotagmin-like (S variant) 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000006603   Gene: ENSECAG00000007471   Transcript: ENSECAT00000008771
Sequence length 553
Comment pep:known chromosome:EquCab2:16:7090619:7109910:-1 gene:ENSECAG00000007471 transcript:ENSECAT00000008771 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLSGASERSVPATKILPVSCRNLLEPRTPSARSDPMVVLYTQSRASQEWREFGRTEVID
NTLNPDFVRKFVLDYFFEEKQNLRFDVYNVDSKTNISKPKDFLGQAFLALGEVIGGQGSR
VERPLTGVPGKKCGTILLIAEELSNCRDIATMQLCANKLDKKDFFGKSDPFLVFYRSNED
GTFTICHKTEVVKNTLNPVWQPFSIPVRALCNGDYDRTVKIDVYDWDRDGSHDFIGEFTT
SYRELSKAQNQFTVYEVLNPRKKCKKKKYVNSGTVTLLSFSVDSEFTFVDYIKGGTQLNF
TVAIDFTASNGNPLQPTSLHYMSPYQLSAYAMALKAVGEIIQDYDSDKLFPAYGFGAKLP
PEGRISHQFPLNNNDEDPNCAGIEGVLESYFQSLRTVQLYGPTYFAPVINQVARAAAKIS
DGSQYYVLLIITDGVISDMTQTKEAIVSASSLPMSIIIVGVGPAMFEAMEELDGDDVRVS
YRGRYAERDIVQFVPFRDYVDRSGNQVLSMARLAKDVLAEIPEQLLSYMRTRDIQPRPPR
PANLSPTPAPEQP
Download sequence
Identical sequences F6UZW7
ENSECAP00000006603 9796.ENSECAP00000006603 ENSECAP00000006603

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]