SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000006609 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000006609
Domain Number 1 Region: 342-397
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000051
Family TSP-1 type 1 repeat 0.00036
Further Details:      
 
Domain Number 2 Region: 397-452
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000471
Family TSP-1 type 1 repeat 0.00049
Further Details:      
 
Domain Number 3 Region: 294-337
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000085
Family TSP-1 type 1 repeat 0.001
Further Details:      
 
Domain Number 4 Region: 452-507
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000183
Family TSP-1 type 1 repeat 0.00096
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000006609
Domain Number - Region: 43-126
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00611
Family Spermadhesin, CUB domain 0.0097
Further Details:      
 
Domain Number - Region: 895-1066,1095-1176
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00623
Family Rhodopsin-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000006609   Gene: ENSECAG00000008040   Transcript: ENSECAT00000008780
Sequence length 1522
Comment pep:known chromosome:EquCab2:20:60514643:61155832:1 gene:ENSECAG00000008040 transcript:ENSECAT00000008780 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKAVRNLLIYIFSTYLLVMFGFNAAQDFWCSTLVKGVIYGSYSVSEMFPKNFTNCTWTLE
NPDPTKYSIYLKFSKKDLSCSNFSLLAYQFDHFSHEKIKDLLRKNHSIMQLCNSKNAFVF
LQYDKNFIQIRRVFPTDFPGLQKKGEEDQKSFFEFLVLNKVSPSQFGCHVLCTWLESCLK
SENGRTESCGIMYTKCTCPQHLGEWGIDEQSLVLLNNVVLPLNEQTEGCLTQELQTTQVC
NLTREAKRPPKEEFGMMGDHTIKSQRPRSVHEKRVPQEQADAAKFMAQTGESGVEEWSQW
STCSVTCGQGSQVRTRTCVSPYGTHCSGPLRESRVCNNTALCPVHGVWEEWSPWSLCSFT
CGRGQRTRTRSCTPPQYGGRPCEGPETHHKPCNIALCPVDGQWQEWSSWSQCSVTCSNGT
QQRSRQCTAAAHGGSECRGPWAESRECSNPECTANGQWNQWGHWSGCSKSCDGGWERRTR
TCQGAAITGQQCDGSGEEVRRCSEQRCPAPYEICPEDYVMSMVWKRTPAGDLAFNQCPLN
ATGTTSRRCSLSLHGVAFWEQPSFARCISNEYRHLQLSIKEHLAKGQRMLAGDGMSQVTK
TLLDLTQRKNFYAGDLLMSVEILRNVTDTFKRASYIPASDGVQNFFQIVSNLLDEENKEK
WEDAQQIYPGSIELMQVIEDFIHIVGMGMMDFQNSYLMTGNVVASIQKLPAASVLTDINF
PMKGRKGMVDWARNSEDRVVIPKSIFTPVSSKELDESSVFVLGAVLYKNLDLILPTLRNY
TVVNSKIIVVTIRPEPKTTDSFLEIELAHLANGTLNPYCVLWDDSKTNESLGTWSTQGCK
TVLTDASHTKCLCDRLSTFAILAQQPREIIMESSGAPSVTLIVGSGLSCLALITLAVVYA
ALWRYIRSERSIILINFCLSIISSNILILVGQTQTHNKSICTTTTAFLHFFFLASFCWVL
TEAWQSYMAVTGKIRTRLIRKRFLCLGWGLPALVVATSVGFTRTRGYGTDHYCWLSLEGG
LLYAFVGPAAAVVLVNMVIGILVFNKLVSRDGILDKKLKHRAGQMSEPHGGLTLKCAKCG
VVSTTALSATTASNAMASLWSSCVVLPLLALTWMSAVLAMTDKRSILFQILFAVFDSLQG
FVIVMVHCILRREVQDAFRCRLRNCQDPINADSSSSFPNGHAQIMTDFEKDVDIACRSVL
HKDIGPCRAATITGTLSRISLNDDEEEKGTNPEGLSYSTLPGNVISKVIIQQPTGLHMPM
SMNELGNQCLKKENSELRRTVYLCTDDNLRGADMDIVHPQERMMESDYIVMPRSSVNTQP
SMKEESKMNIGMETLPHERLLHYKVNPEFNMNPPVMDQFNMNLDQHLAPQEHMQNLPFEP
RTAVKNFMASELDDNAGLSRSETGSTISMSSLERRKSRYSDLDFEKVMHTRKRHMELFQE
LNQKFQTLDRFRDIPNTSSMENPAPNKNPWDTFKNPSEYQHYTTINVLDTEAKDALELRP
AEWEKCLSLPLDVQEGDFQTEV
Download sequence
Identical sequences F6UZP6
ENSECAP00000006609 9796.ENSECAP00000006609 XP_003363778.1.31192 XP_014590008.1.31192 ENSECAP00000006609

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]