SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000006615 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000006615
Domain Number 1 Region: 199-509
Classification Level Classification E-value
Superfamily Cysteine proteinases 3.36e-117
Family Transglutaminase core 0.000000000022
Further Details:      
 
Domain Number 2 Region: 16-198
Classification Level Classification E-value
Superfamily E set domains 7e-56
Family Transglutaminase N-terminal domain 0.0000000158
Further Details:      
 
Domain Number 3 Region: 524-635
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 3.27e-31
Family Transglutaminase, two C-terminal domains 0.00000266
Further Details:      
 
Domain Number 4 Region: 637-734
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 8.37e-27
Family Transglutaminase, two C-terminal domains 0.00000458
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000006615   Gene: ENSECAG00000008295   Transcript: ENSECAT00000008788
Sequence length 739
Comment pep:known chromosome:EquCab2:20:6400472:6553867:-1 gene:ENSECAG00000008295 transcript:ENSECAT00000008788 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KELVTLRMSETSGTTFGGRRAIPPNNSNAAENDPPTVELQGPVPRGVNLQDYLNVTNVHL
FKEKWDTNKLDHHTDKYDSNKLIVRRGQSFYIQIDFNRPYDPRRDLFRVEYVIGRYPQEN
KGTYIPVPVVSELQSGKWGAKVVMRERTSVRLSIQSSPECIVGKFRMYVAVWTPYGVIRT
SRNPETDTYILFNPWCEEDAVYLDDAKEREEYVLNDIGVIFYGDVSDIKSRSWSYGQFED
GILDACLYVMDRAKMDLSGRGNPIKVSRVGSAMVNARDDEGVLVGSWDNVYAYGVPPSAW
TGSVDILLEYHSSENPVRYGQCWVFAGVFNTFLRCLGIPARVVTNYFSAHDNNANLQTDI
FLEEDGNVNSKLTKDSIWNYHCWNEAWMTRPDLPVGFGGWQVVDSTPQENSDGMYRCGPA
SVQALKHGHICFQFDAPFVFAEVNSDVVYITAKKDGTHVVETVDATHIGQLIVTKQVGGD
GIKDITDTYKFQEGQEEERLALETALMYGAKKPLNTEDVTKLKSDVDMDFEVENAVLGKD
FKLTITFRNQSPTRYTISAYLSGNITFYTGVSHVEFKNETFKVTLEPLSVKKEEVLIRAG
EYMGQLLEQASLHFFVTARVNETKVVLAKQKSTVLTIPKVIIKVRGAKVVGSDMVVTVEF
TNPLKQTLRNVWIYLEGPGVIKPKRKLFREIPPNSTVQWEEASRPWVSGRRKLIASMTSD
SLRHVYGELDLQIQRRPAE
Download sequence
Identical sequences F6UZI2
9796.ENSECAP00000006615 ENSECAP00000006615 ENSECAP00000006615

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]