SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000006635 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000006635
Domain Number 1 Region: 550-638
Classification Level Classification E-value
Superfamily PH domain-like 4.3e-20
Family Third domain of FERM 0.0034
Further Details:      
 
Domain Number 2 Region: 360-452
Classification Level Classification E-value
Superfamily PH domain-like 1.18e-18
Family Pleckstrin-homology domain (PH domain) 0.0097
Further Details:      
 
Domain Number 3 Region: 250-301
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000000837
Family Second domain of FERM 0.0078
Further Details:      
 
Domain Number 4 Region: 465-549
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000209
Family Second domain of FERM 0.0064
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000006635
Domain Number - Region: 17-88
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00896
Family Ras-binding domain, RBD 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000006635   Gene: ENSECAG00000008107   Transcript: ENSECAT00000008809
Sequence length 663
Comment pep:known chromosome:EquCab2:12:24515147:24530898:1 gene:ENSECAG00000008107 transcript:ENSECAT00000008809 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGMKTATGDYIDSSWELQVFVGEEEPQAQSVTLRVTGESHIGGVLLKIVEQINRKQDWS
DYAIWWEQKKQWLLQTHWTLDKYGILADARLFFGPQHRPVVLRLPNRRALRLRASFSQPL
FQAVAAICRLLSIRHPEELSLLRTLEKKEKKKKEKEPEEEVYDLTQVVLAGGVAPALFRG
MPAHFSDSAQTEACYHMLSRPQPPPDPLLLQRLPRPSSLLDKTKLHSRWLDSSRCLMQQD
VKAGDTLWLRFKYYSFFDLDPKADPVRLTQLYEQARWDLLLEEIDCTEEEMMVFAALQYH
INKLSQSGEVGEPAGTDPGLDDLDAALNNLEVKLEGSAPTDMLDSLTTIPELKDNLRIFR
PRKLTLKGYRQHWVVFKETTLSYYKSQEEAPGDPVQQLNLKGCEVVPDVNVSGQKFCIKL
LVPSPEGMSEVYLRCQDEQQYARWMAGCRLASKGRTMADSSYASEVQAILAFLSLQRAGG
GGAGNQPQGPDASAEGLNPYGLVSPRFQRKFKAKQLTPRILEAHQNVAQLSLSEAQLRFL
QAWQSLPDFGISYFTVRFKGSKKDEILGIANNRLIRIDLAVGDVVKTWRFSNMRQWNVNW
DIRQVAIEFDEHINVAFSCMSASCRIVHEYIGGYIFLSTRERARGEELDEDLFLQLTGGH
EAF
Download sequence
Identical sequences F6URZ2
ENSECAP00000006635 ENSECAP00000006635 9796.ENSECAP00000006635 XP_001488934.1.31192 XP_014700414.1.49734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]