SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000006671 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000006671
Domain Number 1 Region: 51-501
Classification Level Classification E-value
Superfamily Sema domain 3.14e-130
Family Sema domain 0.0000000526
Further Details:      
 
Domain Number 2 Region: 497-546
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000144
Family Plexin repeat 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000006671   Gene: ENSECAG00000008622   Transcript: ENSECAT00000008851
Sequence length 761
Comment pep:known chromosome:EquCab2:5:42009014:42024426:-1 gene:ENSECAG00000008622 transcript:ENSECAT00000008851 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALPVLGLDPWSLLGLFLFQLLLLLLPPPTAGGSGQGPMPRVKYYAGDGRRALSLFHQKG
LQDFDTLLLSGDGGTLYVGTREAIVALNIQDPGVPRLKNMIPWPASDRKKSECAFKKKSN
ETQCFNFIRVLVSFNATHLYACGTFAFSPACTFIELQDSYLLPILEDKVVEGKGQSPFDP
AHKHTAVLADGMLYSGTMNNFLGSEPILIRTLGSQPVLKTDNFLRWLQPDASFVAAIPST
QVVYFFFEETASEFEFFEKLHTSRVARVCKNDVGGEKLLQKKWTTFLKAQLLCAQPGQLP
FNVIRHAVLLPANSSTESRVYAVFTSQWQIGGTRSSAVCAFSLENIKRVFEGKYKELNKE
TSRWTTYGVPDISPRPGSCSVGPSSDKALTFMKDHFLMDEQVVGTPLLVKSGVEYTRLAV
ETAQDIHGHSHVVMYLGTSEGELETASVEITPSGSLAGETSQLSLSSQVTGSLHKRCSEA
AVFAGFSGGVWRVPRANCSVYESCMDCVLARDPHCAWDPSRICHLLPTPIPKSWKQDMER
GNPDWACANGPMPRSHRPQSRPQIIKEVLAVPNSILELPCPHLSALASYHWSHGRAAVPE
ASSTVYNGSLLLLLRDGVGGLYQCWATENDFSYPVVSYWVDSQDQSLALDPELAGIPRER
VEAPLTRVGGGAALAAQRSYWPHFLTVTVLLALVLSGALIILLTSPLGALRARGKVQGCG
TLPSREKAPLSRERHLQPSKECRTSASDVDADNNHLGTEVA
Download sequence
Identical sequences F6UCF0
9796.ENSECAP00000006671 ENSECAP00000006671 ENSECAP00000006671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]