SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000006722 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000006722
Domain Number 1 Region: 26-397
Classification Level Classification E-value
Superfamily SAICAR synthase-like 9.48e-124
Family Phosphatidylinositol phosphate kinase IIbeta, PIPK IIbeta 0.0000048
Further Details:      
 
Domain Number 2 Region: 496-640
Classification Level Classification E-value
Superfamily vWA-like 8.71e-29
Family Integrin A (or I) domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000006722   Gene: ENSECAG00000008201   Transcript: ENSECAT00000008914
Sequence length 863
Comment pep:known chromosome:EquCab2:5:45994697:46026678:-1 gene:ENSECAG00000008201 transcript:ENSECAT00000008914 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VPCSSGMPIKKIGHRSVDSSGETTYKKTTSSALKGAIQLGITHTVGSLSTKPERDVLMQD
FYVVESIFFPSEGSNLTPAHHYNDFRFKTYAPVAFRYFRELFGIRPDDYLYSLCSEPLIE
LCSSGASGSLFYVSSDDEFIIKTVQHKEAEFLQKLLPGYYMNLNQNPRTLLPKFYGLYCV
QAGGKNIRIVVMNNLLPRSVKMHIKYDLKGSTYKRRASQKEREKPLPTFKDLDFLQDISD
GLFLDADMYNALCKTLQRDCLVLQSFKIMDYSLLMSIHNIDYAQREPLGNEAQHSVDTRR
PAPQKALYSTAMESIQGEARRGGTMETDDYMGGIPARNSKGERLLLYIGIIDILQSYRFI
KKLEHSWKALVHDGDTVSVHRPGFYAERFQRFMCNTVFKKIPLKPSPSKKFRSGSSFSRR
SGPSSNSCVTYQPSVSGEHKAQVTTKAEVEPGVHFGRPDVLPQTPPLEKISEVSTIPDPY
LSPVVGETLQMLTTSVDNSEYMRNGDFLPTRLQAQQDAVNIVCHSKTRSNPENNVGLITL
ANDCEVLTTLTPDTGRILSKLHTVQPKGKITFCTGIRVAHLALKHRQGKNHKMRIIAFVG
SPVEDNEKDLVKLAKRLKKEKVNVDIINFGEEEVNTEKLTAFVNTLNGKDGTGSHLVTVP
PGPSLADALISSPILAGEGGAMLGLGASDFEFGVDPSADPELALALRVSMEEQRQRQEEE
ARRAAAASAAEAGIATTGTEDSDDALLKMTISQQEFSRTGLPDLSSMTEEEQIAYAMQMS
LQGAEFGQAESADIDASSAMDTSEPAKEEDDYDVMQDPEFLQSVLENLPGVDPNNEAIRN
AMGSLASQATKDNKKDKKEEDKK
Download sequence
Identical sequences F6TGG7
ENSECAP00000006722 9796.ENSECAP00000006722 ENSECAP00000006722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]