SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000006723 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000006723
Domain Number 1 Region: 1-96
Classification Level Classification E-value
Superfamily Kringle-like 7.49e-26
Family Kringle modules 0.00094
Further Details:      
 
Domain Number 2 Region: 184-291
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.01e-25
Family Spermadhesin, CUB domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000006723   Gene: ENSECAG00000008652   Transcript: ENSECAT00000008915
Sequence length 448
Comment pep:known chromosome:EquCab2:8:7606141:7647573:-1 gene:ENSECAG00000008652 transcript:ENSECAT00000008915 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ECFTANGADYRGMQNWTAPQGGKPCLFWNETFQHPYNTLKYPHGEGGLGEHNYCRNPDGD
VSPWCYVAEHEDGVYWKYCEIPACQMPGNLGCYKDHGNPPPLTGASKTSNKLTIQTCISF
CRSQRFKFAGMESGYACFCGNNPDYWKYGEAASTECNSVCFGDHTQPCGGDGRIILFDTL
VGACGGNYSAMTSVVYSPDFPDTYAPGRVCYWTIRVPGASHIHFNFTLFDIRDSADMVEL
LDGYTHRVLVRFNGRNRPPLSFNVSLDFVILYFFSDRINQAQGFAVLYQAVKEEPPQERP
TANQTLAEVITEQANHSVSAARSSKVLYVITTSPSHPPQTVPGSSSQTPSQGTEATELEG
STLGGWTVYGLATLLILTVTAIVAKILLHITFKSHRVPASGDLRDCRQPGTSGEIWSIFY
QPATSISIFKKKLKGPSQQDDRNPLVSD
Download sequence
Identical sequences F6TGG2
ENSECAP00000006723 9796.ENSECAP00000006723 ENSECAP00000006723

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]