SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000006751 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000006751
Domain Number 1 Region: 155-345
Classification Level Classification E-value
Superfamily E set domains 4.67e-64
Family Cytoplasmic domain of inward rectifier potassium channel 0.0000194
Further Details:      
 
Domain Number 2 Region: 49-169
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.26e-18
Family Voltage-gated potassium channels 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000006751   Gene: ENSECAG00000008811   Transcript: ENSECAT00000008950
Sequence length 375
Comment pep:known chromosome:EquCab2:26:34411335:34454131:1 gene:ENSECAG00000008811 transcript:ENSECAT00000008950 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDAMHINMSSAPLVKHTAGAGLKTNRPRVMSKSGHSNVRIDKVDGIYLLYLQDLWTTVID
MKWRYKLTLFAATFVMTWFLFGVIYYAIAFIHGDLEPSERISNHTPCIMKVDSLTGAFLF
SLESQTTIGYGVRSITEECPHAIFLLVAQLVITTLIEIFITGTFLAKIARPKKRAETIKF
SHCAVITKQNGKLCLVIQVANMRKSLLIQCQLSGKLLQTHVTKEGERILLNQATVKFHVD
SSSESPFLILPMTFYHVLDETSPLRDLTPQNLKEKEFELVVLLNATVESTSAVCQSRTSY
IPEEIYWGFEFVPVVSLSKTGKYVADFSQFEQIRKSPDCTFYCADAEKQKLEEKYRQEDQ
RERELRTLLLQQSNV
Download sequence
Identical sequences F6T921
XP_001495224.2.31192 XP_008537650.1.77740 XP_008537658.1.77740 XP_014591861.1.31192 XP_014591862.1.31192 XP_014591863.1.31192 XP_014591864.1.31192 XP_014717512.1.49734 XP_014717513.1.49734 XP_014717514.1.49734 XP_014717515.1.49734 XP_014717516.1.49734 XP_014717517.1.49734 ENSECAP00000006751 9796.ENSECAP00000006751 ENSECAP00000006751

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]