SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000006843 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSECAP00000006843
Domain Number - Region: 31-72
Classification Level Classification E-value
Superfamily SRCR-like 0.0785
Family Scavenger receptor cysteine-rich (SRCR) domain 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000006843   Gene: ENSECAG00000008909   Transcript: ENSECAT00000009054
Sequence length 95
Comment pep:known chromosome:EquCab2:5:77124128:77160069:1 gene:ENSECAG00000008909 transcript:ENSECAT00000009054 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVAMAARPGGWLGPAFALRMLLATVLQAVSAFGAEFSSEACRELGFSSNLLCSSCDLLGQ
FNLLPLDPDCRGCCQEEAQFETKKLYAGAILEVCG
Download sequence
Identical sequences F6QYQ4
9796.ENSECAP00000006843 ENSECAP00000006843 ENSECAP00000006843

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]