SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000006872 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000006872
Domain Number 1 Region: 368-426
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000586
Family Laminin-type module 0.022
Further Details:      
 
Domain Number 2 Region: 244-288
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000837
Family Laminin-type module 0.059
Further Details:      
 
Domain Number 3 Region: 424-471
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000753
Family Laminin-type module 0.015
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000006872
Domain Number - Region: 67-124
Classification Level Classification E-value
Superfamily Sialidases 0.00785
Family Sialidases (neuraminidases) 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000006872   Gene: ENSECAG00000008808   Transcript: ENSECAT00000009085
Sequence length 472
Comment pep:known chromosome:EquCab2:25:34590566:34664747:1 gene:ENSECAG00000008808 transcript:ENSECAT00000009085 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLKEYVKVKVEPSGITCGDPPERFCSHENPYLCSNECDASNPDLAHPPRLMFDKEDEGL
ATYWQSVTWSRYPSPLEANITLSWNKSVELTDDVVVTFEYGRPTVMVLEKSLDNGRTWQP
YQFYAEDCMEAFGMPARRARDLAASGAHRVLCTEEYSRWAGSKKEKHVRFEVRDRFAIFA
GPDLRNLDNLYTRLESAKGLKDFFTLTDLRMRLLRPALGGTYVQRENLYKYFYAISNIEV
IGRCKCNLHANLCSVREGSLQCECEHNTTGPDCGKCKKNFRTRSWRAGSYLPLPHGSPNA
CAAAGSAIGKWIRPPTAAPLGKSPPWPQVSSSAEAVGTSATAPAKASKPFQLRPKSPQVM
PLEEFQDCECYGHSNRCSYIDFLNVVTCVSCKHNTRGQHCQHCRLGYYRNGSAELDDENV
CIECNCNQIGSVHDRCNETGFCECREGSAGPKCDDCLPTHYWRQGCYPNVCD
Download sequence
Identical sequences F6S5M0
9796.ENSECAP00000006872 ENSECAP00000006872 ENSECAP00000006872

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]