SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000006899 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000006899
Domain Number 1 Region: 101-234
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 4.37e-26
Family Synaptotagmin-like (S variant) 0.023
Further Details:      
 
Domain Number 2 Region: 266-445
Classification Level Classification E-value
Superfamily vWA-like 1.23e-17
Family Integrin A (or I) domain 0.018
Further Details:      
 
Domain Number 3 Region: 2-75
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0000000000187
Family Synaptotagmin-like (S variant) 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000006899   Gene: ENSECAG00000008178   Transcript: ENSECAT00000009114
Sequence length 464
Comment pep:known chromosome:EquCab2:20:36621209:36668247:-1 gene:ENSECAG00000008178 transcript:ENSECAT00000009114 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QFGRTEVIDNTLNPDFVRKFIVDYFFEEKQNLRFDLYDVDSKSPDLSKHDFLGQAFCTLG
EIVGSPGSRLEKPLVIGAFSLNSRTGKPMPAVSNGGVPGKKCGTIILSAEELSNCRDVAT
MQFCANKLDKKDFFGKSDPFLVFYRSNEDGTFTICHKTEVMKNTLNPVWQTFSIPVRALC
NGDYDRTIKVEVYDWDRDGSHDFIGEFTTSYRELARGQSQFNIYEVVNPKKKMKKKKYVN
SGTVTLLSFAVESECTFLDYIKGGTQINFTVAIDFTASNGNPSQSTSLHYMSPYQLNAYA
LALTAVGEIIQHYDSDKMFPALGFGAKLPPDGRVSHEFPLNGNQENPSCCGIDGILEAYH
HSLRTVQLYGPTNFAPVVTHVARNAAAVQDGSQYSVLLIITDGVISDMAQTKEAIVNAAK
LPMSIIIIGVGQAEFDAMVELDGDDVRISSRGKLAERDIVQVKP
Download sequence
Identical sequences F6RGE6
ENSECAP00000006899 ENSECAP00000006899 9796.ENSECAP00000006899

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]