SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000006952 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000006952
Domain Number 1 Region: 605-908
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.24e-83
Family Protein kinases, catalytic subunit 0.000000000168
Further Details:      
 
Domain Number 2 Region: 28-199
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.32e-66
Family Ephrin receptor ligand binding domain 0.00000854
Further Details:      
 
Domain Number 3 Region: 328-528
Classification Level Classification E-value
Superfamily Fibronectin type III 1.36e-30
Family Fibronectin type III 0.0017
Further Details:      
 
Domain Number 4 Region: 896-966
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.14e-18
Family SAM (sterile alpha motif) domain 0.00098
Further Details:      
 
Domain Number 5 Region: 259-330,366-382
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000167
Family Growth factor receptor domain 0.015
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000006952
Domain Number - Region: 526-555
Classification Level Classification E-value
Superfamily Inovirus (filamentous phage) major coat protein 0.0284
Family Inovirus (filamentous phage) major coat protein 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000006952   Gene: ENSECAG00000007650   Transcript: ENSECAT00000009174
Sequence length 975
Comment pep:known chromosome:EquCab2:2:36900810:36927551:1 gene:ENSECAG00000007650 transcript:ENSECAT00000009174 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERRAPRAGLALLLGCLLAAAAAAQGKEVVLLDFAAAKGELGWLTHPYGKGWDLMQNIMD
DMPIYMYSVCNVVAGDQDNWLRTNWVYRGEAERIFIELKFTVRDCNSFPGGASSCKETFN
LYYAESDVDYGTNFQKRQFTKIDTIAPDEITVSSDFEARHVKLNVEERSVGPLSRKGFYL
AFQDIGACVALLSVRVYYKKCPELLQGLARFPETIAGSDAPSLATVPGTCVDHAVVPPGG
EEPRMHCAVDGEWLVPIGQCLCQAGYEKVEDACQACSPGFFKSEASESPCLECPAHTLPS
PEGATSCECEEGYFRAQQDPLSMPCTRPPSAPHYLTAIGMGAKVELRWTPPQDNGGREDI
IYSVTCEQCWPESGECGPCEASVHYSEPPHALTRTSVTVSDLEPHMNYTFVVEARNGVSD
LVTSRSFRTASVSINQTEPPKVKLEGRSTTSLSVSWSIPPPQQSRVWKYEVTYRKKGDSN
SYNVRRTEGFSVTLDDLAPDTTYLVQVQALTQEGQGAGSKVHEFQTLSTEGSGNMAVIGG
VAVGVLLLLVLAGIGLFIHRRRRSLRTRQSSEDVYFSKSEQLKPLKTYVDPHTYEDPNQA
VLKFTTEIHPSCVTRQKVIGAGEFGEVYKGTLKVSGKKEVPVAIKTLKAGYTEKQRVDFL
SEASIMGQFSHHNIIRLEGVVSKYKPMMIITEYMENGALDKFLREKDGEFSVLQLVGMLR
GIAAGMKYLANMNYVHRDLAARNILVNSNLVCKVSDFGLSRVLEDDPEATYTTSGGKIPI
RWTAPEAISYRKFTSASDVWSYGIVMWEVMTYGERPYWELSNHEVMKAINDGFRLPTPMD
CPSAIYQLMMQCWQQERARRPKFADIVSILDKLIRAPDSLKTLADFDPRVSIRLPSTSGS
EGVPFHTVSEWLESIKMQQYTEHFLAAGYTAIEKVVQMTNDDIKRIGVRLPGHQKRIAYS
LLGLKDQVNTVGIPI
Download sequence
Identical sequences F6QAL5
ENSECAP00000006952 9796.ENSECAP00000006952 XP_001488789.1.31192 ENSECAP00000006952

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]