SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000006981 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000006981
Domain Number 1 Region: 59-507
Classification Level Classification E-value
Superfamily Sema domain 5.89e-142
Family Sema domain 0.0000000917
Further Details:      
 
Domain Number 2 Region: 798-855
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000262
Family TSP-1 type 1 repeat 0.00033
Further Details:      
 
Domain Number 3 Region: 612-662
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000929
Family TSP-1 type 1 repeat 0.00035
Further Details:      
 
Domain Number 4 Region: 855-912
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000144
Family TSP-1 type 1 repeat 0.00038
Further Details:      
 
Domain Number 5 Region: 503-552
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000732
Family Plexin repeat 0.0049
Further Details:      
 
Domain Number 6 Region: 666-718
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000017
Family TSP-1 type 1 repeat 0.00084
Further Details:      
 
Domain Number 7 Region: 913-957
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000445
Family TSP-1 type 1 repeat 0.0021
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000006981
Domain Number - Region: 557-609
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00034
Family TSP-1 type 1 repeat 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000006981   Gene: ENSECAG00000008520   Transcript: ENSECAT00000009206
Sequence length 1099
Comment pep:known chromosome:EquCab2:19:36567429:36606298:1 gene:ENSECAG00000008520 transcript:ENSECAT00000009206 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RTAEGPTMVFPGPLAVTLLPPSLTLLVFHLSSSQDVTSDPSSEQLCTLREHPIVAFADLK
PWISNFTYPGARDFSQLALDPSRNQLIVGARNYLFRLSLANVSLLQATEWASNEDTRRSC
QSKGKTEEECQNYVRVLIVAGRKVFMCGTNAFSPVCSSRQVGNLSRTMEKINGVARCPYD
PRHNSTAVISSQGELYAATVIDFSGRDPAIYRSLGSGPPLRTAQYNSKWLNEPNFVAAYD
IGLFAYFFLRENAVEHDCGRTVYSRVARVCKNDVGGRFLLEDTWTTFMKARLNCSRPGEV
PFYYNELQSAFHLPEQDLIYGVFTTNINSIAASAVCAFNLSAISQAFNGPFRYQENPRAA
WLPIANPLPNFQCGTLPEVGPNENLTERSLQDAQRLFLMSEAVQPVTPEPCVTQDSVRFS
HLVVDLVQAKDTLYHVLYISTESGTILKALSTTSRSLRGCYLEELHVLPPGRREPLRSLR
ILHSARALFVGLSDSVLRVPLERCAAYRSQGACLGARDPYCGWDGKQQRCSTLEDSSNMS
LWTQNITACPVRNVTRDGGFGQWSPWQPCEHLDGDNSGSCLCRARACDSPQPRCGGRNCL
GPAIHIANCSRNGAWTPWSSWALCSTSCGIGFQVRQRSCSNPAPRHGGRICVGKSREERF
CNENTPCPVPIFWASWGSWSKCSSNCGGGVQSRRRSCENGDSCPGCGVEFKTCNPEGCPE
VRRNTPWTPWLPVNVTQGGARQEQRFRFTCRAPLPDPHGLQFGRRRTETRTCPADGSGAC
DTDALVEDLLRSGGTSPHTVSGGWAAWGPWSSCSRDCELGVRVRKRTCTNPEPRNGGLPC
VGDAAEYQDCNPQACPVRGAWSCWTSWSPCSASCGGGHYQRTRSCTNPTPSPGEDICLGL
HTEEALCATQACPEGWSLWSEWSTCTEDGAQSRSRRCEELVLGPSTCAGNSSQSRPCPYS
EIPVILPASSVEETTGCGGFNVIHLVATGVSCFLGSGLLTLAVYLSCQHCQRQTQESTLV
HPATPNHLHYKGGGTPKNEKYTPMEFKTLNKNNLIPDDRANFYPLQQTNVYTTTYYPSPL
NKHSFRPEASPGQRCFPNS
Download sequence
Identical sequences F6Q1V3
ENSECAP00000006981 9796.ENSECAP00000006981 ENSECAP00000006981

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]