SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000006990 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000006990
Domain Number 1 Region: 23-142,334-644
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 7.32e-69
Family Integrin alpha N-terminal domain 0.0000976
Further Details:      
 
Domain Number 2 Region: 162-357
Classification Level Classification E-value
Superfamily vWA-like 1.08e-45
Family Integrin A (or I) domain 0.00000443
Further Details:      
 
Domain Number 3 Region: 644-791
Classification Level Classification E-value
Superfamily Integrin domains 1.99e-23
Family Integrin domains 0.0024
Further Details:      
 
Domain Number 4 Region: 792-929
Classification Level Classification E-value
Superfamily Integrin domains 9.68e-23
Family Integrin domains 0.0051
Further Details:      
 
Domain Number 5 Region: 964-1093
Classification Level Classification E-value
Superfamily Integrin domains 0.000000000167
Family Integrin domains 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000006990   Gene: ENSECAG00000008533   Transcript: ENSECAT00000009218
Sequence length 1167
Comment pep:known chromosome:EquCab2:5:47953641:47968614:1 gene:ENSECAG00000008533 transcript:ENSECAT00000009218 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELPLIPHLFLLLMFLTGLCFPFNLDVHRPRLFPGPPTAEFGYSVLQHVGGGRRWMLVGA
PWDGPSGNRRGDIYRCPVGGSHNAPCAKGHLGDYPLGNSSRPAVNMHLGMSLLETDGDGG
FMACAPLWSRACGSSVFSSGICARVDASFQLQGSLAPTAQRCPTYMDVVIVLDGSNSIYP
WSEVRTFLRRLVGRLFIDPEQIQVGLVQYGESPVHEWSLGDFRTKEEVVRAARNLSRREG
RETKTAQAIMVACTEGFSQSHGGRPEAARLLVVVTDGESHDGEELPTALKACEAGRVTRY
GIAVLGHYLRRQRDPSSFLREIRAIASDPDERFFFNVTDEAALTDIVDALGDRIFGLEGS
HGENESSFGLEMSQIGFSTHRLKDGILFGMVGAYDWGGSVLWLEEGHRIFPSRTALEDEF
PPALQNHAAYLGYSVSSMLLRGGRRFFLSGAPRFRHRGKVIAFQLKKDGAMRVAQSLQGE
QIGSYFGSELCPLDMDGDGTTDVLLVAAPMFLGPQNKETGRVYVYLVGQQSLLTLQGTLQ
PEPPQDARFGFAMGALPDLNQDGFADVAVGAPLEDGHHGALYLYHGTQSGVKPRPAQRIA
AISMPQTLSYFGRSVDGRLDLDGDDLVDVAVGAQGAAILLSSRPIVHLAPTLDVTPPAIS
VVQRDCRRRGQEAACLSAALCFQVTSRTPGHWDRRFYMRFTASLDEWTAGARAAFDGSGQ
RLSSRRLRLSVGNVTCEQLHFHVLDTSDYLRPVALTVTFALDNTTKPGPVLDEASFTSIQ
KLVPFSKDCGPDNECITDLVLRVNMDIRGSRKDPFMVRGGRQKVLVSAALENRKENAYNT
SLSLSFSRNLHLASFTPQRDSPVKVECTAPSSHARLCSVGHPVFQTGAKVTFQLEFEFSC
SSLLSQVLVRLTATSNSLERNGTLQDNTAQTSAYIQYEPHLLFSSESTLHRYEVHPYGTL
PVGPGPEFKTTLRVQNLGCYVISGLIISALLPAVAHGGNYFLSLSQVISNNASCTVHNLT
EPPGPPLHPEELQHTSRLNGSNTRCQVVRCHLGRLAKGTEVSVGLLRLVHNEFFRRAKFK
SLTVVSTFELGTEEGSVLQLTEASRWSESLLEVIQTRPVLISLWILIGSVLGGLLLLALL
VFCLWKLGFFARKKIPKEEKREEKLEQ
Download sequence
Identical sequences F6Q1A0
ENSECAP00000006990 XP_014595405.1.31192 ENSECAP00000006990 9796.ENSECAP00000006990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]