SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000007061 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000007061
Domain Number 1 Region: 144-187
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000132
Family EGF-type module 0.0053
Further Details:      
 
Domain Number 2 Region: 65-184,279-286
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000345
Family Growth factor receptor domain 0.0043
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000007061
Domain Number - Region: 199-228
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.0732
Family Mitotic arrest deficient-like 1, Mad1 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000007061   Gene: ENSECAG00000009021   Transcript: ENSECAT00000009298
Sequence length 295
Comment pep:known chromosome:EquCab2:20:31814276:31816294:1 gene:ENSECAG00000009021 transcript:ENSECAT00000009298 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSRAELCTLLGGLSFLLLLMSGEGAKGGSFKESQGVCSKQMLVVPLRYNESYSQPVYKP
YLTLCAGRRVCSTYRTTYHVAWREVRREVQQTHIVCCQGWKKRHPGALTCDEAICAKPCL
NRGVCVRPDQCECAPGWGGKHCHVDVDECRTGISLCSHRCLNTAGSFTCGCPHGLVLGPD
GRTCAEGSPEPPTSGSILSVAVREVEQDEHALRQEMQELRGRLEQLEQWAGQVGAWVRAV
LPVPPEDLQPEQVAELWGRGDRIESLSDQVLLLEERLGACSCEDNSLGPGLNRRR
Download sequence
Identical sequences F6XIA3
ENSECAP00000007061 ENSECAP00000007061 9796.ENSECAP00000007061

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]