SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000007208 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000007208
Domain Number 1 Region: 85-402
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.52e-119
Family Transglutaminase core 0.0000000139
Further Details:      
 
Domain Number 2 Region: 556-654
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 2.41e-27
Family Transglutaminase, two C-terminal domains 0.00022
Further Details:      
 
Domain Number 3 Region: 443-554
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 1.02e-25
Family Transglutaminase, two C-terminal domains 0.00032
Further Details:      
 
Domain Number 4 Region: 2-84
Classification Level Classification E-value
Superfamily E set domains 4.9e-18
Family Transglutaminase N-terminal domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000007208   Gene: ENSECAG00000009004   Transcript: ENSECAT00000009466
Sequence length 657
Comment pep:known chromosome:EquCab2:1:145676227:145699524:1 gene:ENSECAG00000009004 transcript:ENSECAT00000009466 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SGPLPDLAKGTRAIFSLASRHGPSPWIASLETNGAASLEVSLCAPPTAAVGRYLLKVHLN
SFQGSVMAYQLGEFILLFNPWCPEDAVYLDSEPQRQEYVVNDYGFIYQGNKNWIRPCPWN
YGQVKEEHLVGIGRYLFDKSLHFQIDPAIDCALRGSPVYISRVVCAMINSNDDNGVLNGN
WSENYFDGINPVEWTGSVAILKQWHATGCQPVRYGQCWVFAAVMCTVMRCLGIPTRVITN
FDSGHDTDGNLIIDEYYDNTGRILENKKKDTVWNFHVWNECWMARKDIPPGYGGWQVLDA
TPQETSNGLYCCGPASVRAIKEGEVDLNYDTAFAFSMVNADCMSWLVYGGKEQKLHQDTN
SVGNFISTKSIQSDERDDITENYKYPEGSPQEREVFLKALKLKARRSPGSHRAASQPSRP
RSLSGDGPRSLDTPSLRPSDVVQVSMKFQLLDPPNMGQDIRFVLLTLNMSLQFKDLKVNL
SAQSLLHDGSPLPPFWQDTAFITLSPEEAKTYPCKIPYSQYSQYLSTDKLIRISALGEEK
SSPEKILVNKIITLAYPGIMINVLGEAVVNQPLSIQVIFSNPLLEPVADCELTVEGSGLF
KKQQRVLIGVLKPQHRASITLETVPFKSGQRQIQANLRSNKFKDIKGYRNIYVDSRL
Download sequence
Identical sequences F6YCS3
ENSECAP00000007208 ENSECAP00000007208 9796.ENSECAP00000007208

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]