SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000007211 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000007211
Domain Number 1 Region: 400-545
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.28e-27
Family MAM domain 0.00097
Further Details:      
 
Domain Number 2 Region: 138-263
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000314
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 3 Region: 93-130
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000641
Family EGF-type module 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000007211   Gene: ENSECAG00000009218   Transcript: ENSECAT00000009469
Sequence length 554
Comment pep:known chromosome:EquCab2:X:9281290:9341850:1 gene:ENSECAG00000009218 transcript:ENSECAT00000009469 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPSWAFALPLLLPWVAGGLGNAASPRDHGLSAPAFQPGVCRYGSKLACCYGWRRSSKGV
CEAMCEPGCKFGECVGPNKCRCFPGYTGKSCSQDVNECGVKPRPCQHRCVNTHGSYKCFC
LNGYMLMPDATCANSRTCAMTNCQYRCEDTEEGPRCVCPSSGLRLAPDGRACIDIDECAS
GKAVCPYNRRCVNTFGSYYCKCHVGFKLKYISGRYDCVDVNECAVNTHTCSLYANCLNTQ
GSFKCRCKQGYKGNGLQCSVIPENSVKEVLRAPGTIKDRIKKLLAHKNSMKKKVKIKNGI
TEPSGTPTPKVNLQPFNSEESVSRDGNPDGDKEKNEERKKEELEEEKRDEKALKNHVEQE
QSLRGDVFSPKVNEAGEFGLVLTQGKAVTSRLEHKDLNVSVDCSFDHGVCDWKQDVEDDF
DWNPADRDNAVGYYMAVPALAGHKKDVGRLKLLLPDLQPQSNFCLLFHYRLAGDKVGKLR
VFVKNSNNALAWEETRSEDEKWKMGKIQLYQGIDATKTIIFEAERGKGKTGEIAVDGVLL
VSGSCPDGLVSVDC
Download sequence
Identical sequences F6YCP9
ENSECAP00000007211 9796.ENSECAP00000007211 ENSECAP00000007211 XP_014584246.1.31192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]