SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000007267 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000007267
Domain Number 1 Region: 783-833
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000921
Family Laminin-type module 0.0069
Further Details:      
 
Domain Number 2 Region: 877-929
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000474
Family Laminin-type module 0.0038
Further Details:      
 
Domain Number 3 Region: 345-397
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000053
Family Laminin-type module 0.037
Further Details:      
 
Domain Number 4 Region: 831-879
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000112
Family Laminin-type module 0.0067
Further Details:      
 
Domain Number 5 Region: 281-347
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000795
Family Laminin-type module 0.034
Further Details:      
 
Domain Number 6 Region: 986-1036
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000112
Family Laminin-type module 0.0033
Further Details:      
 
Domain Number 7 Region: 938-988
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000112
Family Laminin-type module 0.05
Further Details:      
 
Domain Number 8 Region: 468-522
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000419
Family Laminin-type module 0.008
Further Details:      
 
Domain Number 9 Region: 1094-1136
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000137
Family Laminin-type module 0.022
Further Details:      
 
Domain Number 10 Region: 1038-1091
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000024
Family Laminin-type module 0.0025
Further Details:      
 
Domain Number 11 Region: 1142-1189
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000865
Family Laminin-type module 0.017
Further Details:      
 
Domain Number 12 Region: 429-470
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000193
Family Laminin-type module 0.024
Further Details:      
 
Domain Number 13 Region: 1548-1672
Classification Level Classification E-value
Superfamily Prefoldin 0.0000863
Family Prefoldin 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000007267   Gene: ENSECAG00000008303   Transcript: ENSECAT00000009530
Sequence length 1796
Comment pep:known chromosome:EquCab2:4:7851554:7920868:-1 gene:ENSECAG00000008303 transcript:ENSECAT00000009530 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AVSPRRQGLDMRLLQVFAFSVVALCGAQVGAQEPEFSYGCAEGSCYPATGDLLIGRARRL
SVTSTCGLHKPEPYCIVSHLQEDKKCFICDSQDPYHDTLNPDSHLIENVVTTFAPNRLKI
WWQSENGVENVTIQLDLEAEFHFTHLIMTFKTFRPAAMLIERSSDFGKTWGVYRYFAYDC
ESSFPGISTGPMKKVDDIICDSRYSDIEPSTEGEVIFRALDPAFRIEDPYSPRIQNLLKI
TNLRIKFVKLHTLGDNLLDSRMEIREKYYYAVYDMVVRGNCFCYGHASECAPVDGFDEEV
EGMVHGHCMCRHNTKGLNCELCMDFYHDLPWRPAEGRNSNACKKCNCNEHSSSCHFDMAV
YLATGNVSGGVCDDCQHNTMGRNCEQCKPFYFQHPERDIRDPNLCEQCACNPAGSQNGGI
CDSYTDFSAGLIAGQCRCKLYVEGENCDICKEGFYGLSAEEPFGCKSCACNPLGTIPGGS
PCDSGTGYCYCKRLVTGQHCDQCLPEHWGLSNDLDGCRPCDCDLGGALNNRSREDGQTAS
LLWHSPNYVINSGTSYVFFTLNHFLQESRRGERGPSLVLCEVTYPHILGMRTWTSLGAIT
LPTTGLDNFFAKGVNVELEPQSVSREEGSLPDHWEKAVITVQRPGKIPPSSRCGNTIPDD
DNQVVSLSPGSRYVVLPRPVCFEKGVNYTVRLELPQYTSSDSDVDSPYTLIDSLVLMPFC
KSLDIFTVGGSGDGLVTNSAWETFQRYRCLENSRSVVKTPMTDVCRNIIFSISALLHQTG
LACECDPQGSLSSVCDPNGGQCQCRPNVVGRTCDRCAPGTFGFGPSGCKPCECHLQGSVN
AFCHPVTGQCHCFQGVYTRQCDRCLPGYWGFPSCQPCQCNGHADDCDTVTGECVSCQDYT
TGHNCERCLAGYYGDPIIGSGDHCRPCPCPDGPDSGRQFASSCYQDPGTLQLECVCNPGY
VGSRCDDCAAGFFGNPLDVGGTCQPCQCHHNIDTTDPEACDKETGRCLKCLYHTEGEHCQ
LCRFGYYGDALQQECRKCVCNSLGTVQEHCNSSECQCDKTTGQCLCLPNVIGQNCDRCAP
NTWQLASGTGCDPCHCDAAHSFGPSCNEFTGQCQCMPGFGGRTCSECQELFWGDPNVECR
ACDCDPRGIETPQCDQSTGQCICVEGVEGPRCDKCTRGYSGVFPDCAPCHQCFALWDVII
AELTNRTQKFLERAKALKISGVIGPYRETVDSVEKKVSEIRDILAQSPAAEPLKNIGNLF
EEAEKLTKDVTEKMAQAEVTLADTASQSNSTAKELDALQTEAESLDNTVKELAEQLEFIK
NSDIRGALDSITKYFQMSLEAEERVNASTTDSSSTVEQSAFTRDKVEALIVEGESQFREN
QEEQAGLLDELAGKLQSLDLSAAAEMTCGTPPGASCSETECGGPNCRTDDGQKKCGGPGC
GGLVTVAHSAWQKAMDFDRDVLSALAEVEQLSKMVSEAKLRADEAKQNAQDVLLKTNATK
EKVDKSNEDLRDLIKQIRNFLTQDSADLDSIEAVANEVLKMEMPSTPQQLQNLTEDIRER
VESLSQVEVILQQSAADIARAEMLLEEAKRASKSATDVKVTADMVKEALEEAEKAQIAAE
KAIKQADEDIQGTQNLLTSIESETAASEETLFNASQRISELERNVEELKRKAAQNSGEAE
YIEKVVYTVKQSADDVKKTLDGELDEKYKKVENLIAKKTEESADARRKAEMLQNEAKTLL
AQANSKLQLLKDLERKYEDNQKYLEDKAQELVRLEGEVRSLLKDISQKVAVYSTCL
Download sequence
Identical sequences F6Y5K6
ENSECAP00000007267 9796.ENSECAP00000007267 ENSECAP00000007267

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]