SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000007269 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000007269
Domain Number 1 Region: 833-938
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000124
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 2 Region: 548-590
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000559
Family EGF-type module 0.0061
Further Details:      
 
Domain Number 3 Region: 727-860
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000957
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 4 Region: 938-1065
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000314
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 5 Region: 627-737
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000581
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 6 Region: 390-496,547-590
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000188
Family Growth factor receptor domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000007269   Gene: ENSECAG00000008859   Transcript: ENSECAT00000009534
Sequence length 1174
Comment pep:known chromosome:EquCab2:16:2529970:2588876:1 gene:ENSECAG00000008859 transcript:ENSECAT00000009534 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLLWEPVEAWLVLALALALALGPSVGVAAPRQDCTGVECPPLEHCIEEALEPGACCATC
VQHGCACEGYQYYDCLQGGFVRGRVPAGQSYFVDFGSTECSCSPGGGKISCQFMLSSATS
SPSCHADTEGHAGRLHGNFSDAEEGDPERHYEDPYSYDQEVAEAEAAAALAGELPAGARR
PASLGGGSQPPSAIQATPWPAALPRPTVAAALGPPAPVQAKARRVTEDSQEEGDEEREEL
MVREWLAAGGPEGLDGPPAAGPAGPGLPVQEGGAEARAGPEENLIPDAQAAPHSTGQEGA
GPVLESSTASVLPSQATLSSPGGPTKPSAHAILTTSPQEATLVPPTQDVPKQLPVLPRPR
PEEDTDPNSVHSVPRGDSEVSTKDLIETCCAAGQQWAIDNDECLEIPESGAEGDVCRTAQ
KHCCVSYLKEKSCMAGVMGAKEGEACGAEDSDTCGSSIFKQCCDCCGLGLRVRAEGQSCE
SNPNLGYPCNQVMLSCCEGEDPLIVPDVRRPPEPEAVPRRVSEAELANREALSLDTETEL
PNSLPGDDQDECLLLPGELCQHLCINTVGSYRCACFPGFSLQDDGRTCRPDGDPAQPDAA
EESALRPESSQVAPNTIPLPLPQPNTCKDHGPCKQVCSVIGDTAMCSCFPGYAIMADGVS
CEDQDECLLGAHDCSRRQFCVNTLGSFYCVNHTVLCAEGFILNMHRKCVDINECVTDLHT
CSRGEHCVNTVGSFHCYKALTCEPGYALKDGECADMDECEQGTHNCQAGFTCQNTQGSFY
CQARPRCMDGFLQDPEGNCVDINECTSLSEPCQPGFSCVNTVGSYTCQRNPLLCARGYHA
SPDGTKCVDVNECETGMHQCGEAQVCHNLPGSYRCDCKAGFQRDAFGRACIDVNECWTSP
GRLCQHTCENTRGSYRCSCASGFRLAADGKRCEDVNECEAQRCSQECNIYGSYQCYCRKG
YQLAEDGHTCTDIDECIQGAGILCTFRCVNVPGSYQCACPERGYTMMANGRSCKDLDECA
LGTHNCSEAETCHNIPGGFRCLRFECPPNYVRVSETKCERTTCHDFVECQSSPARITYYQ
LNFQTGFLVPANIFRISPVPAFAGDTIALTITKGNEEGYFGTRRLNAYTGVVYLQRAVRE
PRDFALDVEMKLWRQGSVTTFLAKMHVFFTTFAV
Download sequence
Identical sequences F6Y5I8
9796.ENSECAP00000007269 ENSECAP00000007269 ENSECAP00000007269

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]