SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000007392 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000007392
Domain Number 1 Region: 40-176
Classification Level Classification E-value
Superfamily C-type lectin-like 1.26e-38
Family C-type lectin domain 0.000000521
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000007392   Gene: ENSECAG00000009200   Transcript: ENSECAT00000009671
Sequence length 177
Comment pep:known chromosome:EquCab2:15:24573402:24576085:1 gene:ENSECAG00000009200 transcript:ENSECAT00000009671 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DMMLSTKALPSMSWMLLSCLMLLSQVQGEDSQKNLPSPRLSCPKGSNAYGSHCYALFMTP
KSWMDADIACQKRPSGHLVSILSGAEASFVGSLVKNTVNTYSYIWIGLHDPTQGYEPYAD
GWEWSSTDVLNYFAWERDPATVSNPGYCASLSQSTGYLKWKDYNCDVKLPYICKFDA
Download sequence
Identical sequences F6WS35
9796.ENSECAP00000007392 ENSECAP00000007392 ENSECAP00000007392

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]