SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000007488 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000007488
Domain Number 1 Region: 2-103
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.11e-23
Family Spermadhesin, CUB domain 0.0000373
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000007488   Gene: ENSECAG00000009596   Transcript: ENSECAT00000009787
Sequence length 108
Comment pep:known chromosome:EquCab2:1:10308209:10310340:1 gene:ENSECAG00000009596 transcript:ENSECAT00000009787 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YSGCGGLLTDLSGRISNYIGPKTVCVWTIQMTPGLDVAMAIPGLNLTCHKEYVEIQDGPP
GSASYGKICEGLGLTFRSSSNILTVKYTRKPDHPASSFDVYYYGEPEG
Download sequence
Identical sequences F6YF43
ENSECAP00000007488 ENSECAP00000007488 9796.ENSECAP00000007488

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]