SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000007489 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000007489
Domain Number 1 Region: 2001-2301
Classification Level Classification E-value
Superfamily BEACH domain 2.49e-128
Family BEACH domain 0.0000000000123
Further Details:      
 
Domain Number 2 Region: 2418-2671
Classification Level Classification E-value
Superfamily WD40 repeat-like 3e-30
Family WD40-repeat 0.0063
Further Details:      
 
Domain Number 3 Region: 1889-1996
Classification Level Classification E-value
Superfamily PH domain-like 3.26e-30
Family PreBEACH PH-like domain 0.00000224
Further Details:      
 
Domain Number 4 Region: 10-133
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.47e-21
Family Clostridium neurotoxins, the second last domain 0.057
Further Details:      
 
Domain Number 5 Region: 225-332,411-707
Classification Level Classification E-value
Superfamily ARM repeat 1.86e-16
Family Plakophilin 1 helical region 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000007489   Gene: ENSECAG00000008985   Transcript: ENSECAT00000009788
Sequence length 2684
Comment pep:known chromosome:EquCab2:17:13839296:14433268:1 gene:ENSECAG00000008985 transcript:ENSECAT00000009788 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPLNNINVDKDKPYLYCFRTSKGVGYSAHFVGNCLIVTSLKSKGKGFQHCVKYDFQPRK
WYMISIVHIYNRWRNSEIRCYVNGQLVSYGDMAWHVNTNDSYDKCFLGSSETADANRVFC
GQLGAVYVFSEALNPAQIFAIHQLGPGYKSTFKFKSESDIHLAEHHKQVLYDGKLASSIA
FTYNAKATDAQLCLESSPKENASIFVHSPHALMLQDVKAIVTHSIHSAIHSIGGIQVLFP
LFAQLDNRQLNDSQVETTVCATLLAFLVELLKSSVAMQEQMLGGKGFLVIGYLLEKSSRV
HITRAVLEQFLSFAKYLDGLSHGAPLLKQLCDHILFNPAIWIHTPAKVQLSLYTYLSAEF
IGTATIYTTIRRVGTVLQLMHTLKYYYWVINPADSSGITPKGLDGPRPSQKEIISLRAFM
LLFLKQLILKDRGVKEDELQSILNYLLTMHEDENIHDVLQLLVALMSEHPASMIPAFDQR
NGIRVIYKLLASKSESIWVQALKVLGYFLKHLGHKRKVEIMHTHSLFTLLGERLMLHTNT
VTVTTYNTLYEILTEQVCTQVVHKPHPEPDSTVKIQNPMILKVVATLLKNSTPSAELMEV
RRLFLSDMIKLFSNSRENRRCLLQCSVWQDWMFSLGYINPKNSEEQKITEMVYNIFRILL
YHAIKYEWGGWRVWVDTLSIAHSKVTYEAHKEYLAKMYEEYQRQEEENIKKGKKGNVSTI
SGLSSQTTGAKGGMEIREIEDLSQSQSPESETDYPVSTDTRDLLMSTKVSDDILGNSDRP
GGGVHVEVHDLLVDIKAEKVEATEVKLDDMDLSPETLVGGENGALVEVESLLDNVYSAAV
EKLQNNVHGSVGIIKKNEEKDNGPLITLADEKDEIPNSGTSFLFDKIPKQEEKLLPELSS
NHIIPNIQNTQVHLGVSDDLGLLAHMTSSVDLTCTSSIIEEKEFKIHTTSDGMSSISERD
LPSSSKGLEYAEMTATALETESSGSKIVPNIDAGSIISDTERSDDGKEPGKEIRKIQTTT
TTQAVQGRSITQQDRDLRVDLGFRGMPMTEEQRRQFSPGPRTTMFRIPEFKWSPMHQRLL
TDLLFALETDVHVWRSHSTKSVMDFVNSNENIIFVHNTIHLISQMVDNIIIACGGILPLL
SAATSPTVSTKTELENIEVTQGMSAETAVTFLSRLMAMVDVLVFASSLNFSEIEAEKNMS
SGGLMRQCLRIVCCVAVRNCLECRQRQRDRGNKSSHGSSKPQEAPQSVTATAASKTPLEN
VPGNLSPIKDPDRLLQDVDINRLRAVVFRDVDDSKQAQFLALAVVYFISVLMVSKYRDIL
EPQRETARTGSQPGRNIRQEINSPTSTVVVIPSIPHPSLNHGFLAKLIPEQSFAHSFYKE
TPAAFPDTIKEKETPTPGEDIQLESSIPHTDSGIGEEQVASILNGAELETNTGPDAMSEL
LSTLSSEVKKSQESLTENPSEMLKPAPSISSISQTKGINVKEILKSLVAAPVEIAECGPE
PIPYPDPALKREAQAILPMQFHSFDRSVVVPVKKLPPGSLAVTTVGATAAGSGLPTGSTS
NIFAATGATPKSMINTTGAVDSGSSSSSSSSSFVNGATSKNLPAVQTVAPMPEDSAENMS
ITAKLERALEKVAPLLREIFVDFAPFLSRTLLGSHGQELLIEGLVCMKSSTSVVELVMLL
CSQEWQNSIQKNAGLAFIELINEGRLLCHAMKDHIVRVANEAEFILNRQRAEDVHKHAEF
ESQCAQYAADRREEEKMCDHLISAAKHRDHVTANQLKQKILNILTNKHGAWGAVSHSQLH
DFWRLDYWEDDLRRRRRFVRNAFGSTHAEALLKAAIEYGYIQREGMKSKKTFRSQAIVNQ
NAETELMLEGDDDAVSLLQEKEIDNLAGPVVLSTPAQLIAPVVVAKGTLSITTTEIYFEV
DEDDPAFKKIDTKVLAYTEGLHGKWMFSEIRAVFSRRYLLQNTALEVFMANRTSVMFNFP
DQATVKKVVYSLPRVGVGTSYGLPQARRISLATPRQLYKSSNMTQRWQRREISNFEYLMF
LNTIAGRTYNDLNQYPVFPWVLTNYESEELDLTLPGNFRDLSKPIGALNPKRAVFYAERY
ETWEDDQSPPYHYNTHYSTATSTLSWLVRIEPFTTFFLNANDGKFDHPDRTFSSVARSWR
TSQRDTSDVKELIPEFYYLPEMFVNSNGYHLGVREDEVVVNDVDLPPWAKKPEDFVRINR
MALESEFVSCQLHQWIDLIFGYKQRGPEAVRALNVFHYLTYEGSVNLDSITDPVLREAME
AQIQNFGQTPSQLLIEPHPPRSSAMHLCFLPQSPLMFKDQMQQDVIMVLKFPSNSPVTHV
AANTLPHLTIPAVVTVTCSRLFAVNRWHNTVGLRGAPGYSLDQAHHLPIEMDPLIANNSG
VNKRQITDLVDQSIQINAHCFVVTADNRYILICGFWDKSFRVYSTETGKLTQIVFGHWDV
VTCLARSESYIGGDCYIVSGSRDATLLLWYWSGRHHIIGDNPNSSDYPAPRAVLTGHDHE
VVCVSVCAELGLVISGAKEGPCLVHTITGDLLRALEGPENCLFPRLISVSSEGHCIIYYE
RGRFSNFSINGKLLAQMEINDSTRAILLSSDGQNLVTGGDNGVVEVWQACDFKQLYIYPG
CDAGIRAMDLSHDQRTLITGMASGSIVAFNIDFNRWHYEHQNRY
Download sequence
Identical sequences F6YF36
ENSECAP00000007489 9796.ENSECAP00000007489 ENSECAP00000007489

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]