SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000007557 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000007557
Domain Number 1 Region: 74-246
Classification Level Classification E-value
Superfamily E set domains 4.41e-33
Family Arrestin/Vps26-like 0.019
Further Details:      
 
Domain Number 2 Region: 6-75
Classification Level Classification E-value
Superfamily E set domains 0.0000000000091
Family Arrestin/Vps26-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000007557   Gene: ENSECAG00000009400   Transcript: ENSECAT00000009864
Sequence length 316
Comment pep:known chromosome:EquCab2:1:103510741:103572903:1 gene:ENSECAG00000009400 transcript:ENSECAT00000009864 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GESILLLQPGKHEFPFSFQLPSEPLVTSFTGKYGSIQYCVRAVLERPKVPDQSVKRELQV
VSHIDVNTPALLTPVLKTQEKMVGCWIFTSGPVSLSAKIERKGYCNGEAIPIYAEIENCS
SRLIVPKAAIFQTQTYLASGKIKTVRHMVANVRGNHIASGSTDIWNGKTLKIPPVTPSIL
DCCIIRVDYSLAVYIHIPGAKKLMLELPLVIGTIPYNGFGSRNSSIASQFSVDMSWLTLT
LPEQPEAPPNYADVVSEEEFSRHVPPYPPPPDCEEEACCPVFACIQEFRFQPPPLYSEVD
PHPSDVEDTQPVSFIL
Download sequence
Identical sequences F6XKB4
9796.ENSECAP00000007557 ENSECAP00000007557 ENSECAP00000007557

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]