SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000007597 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSECAP00000007597
Domain Number - Region: 41-139
Classification Level Classification E-value
Superfamily E set domains 0.0532
Family Arrestin/Vps26-like 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000007597   Gene: ENSECAG00000009507   Transcript: ENSECAT00000009908
Sequence length 326
Comment pep:known chromosome:EquCab2:1:57383148:57406524:1 gene:ENSECAG00000009507 transcript:ENSECAT00000009908 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QSFLGGFFGPICEIDVVLNDGETRKMAEMKTEDGKVEKHYLFYDGESVSGKVNLAFKQPG
KRLEHQGIRIEFVGQIELFNDKSNTHEFVNLVKELALPGELTQSRSYDFEFMQVEKPYES
YIGANVRLRYFLKVTIVRRLTDLVKYDLIVHQLATYPDVNNSIKMEVGIEDCLHIEFEYN
KSKYHLKDVIVGKIYFLLVRIKIQHMELQLIKKEITGIGPSTTTETETIAKYEIMDGAPV
KGESIPIRLFLAGYDPTPTMRDVNKKFSVRYFLNLVLVDEEDRRYFKQQEIILWRKAPEK
LRKQRTNFHQRFESPESQASAEQPEM
Download sequence
Identical sequences F6X917
ENSECAP00000007597 9796.ENSECAP00000007597 ENSECAP00000007597

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]