SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000007670 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000007670
Domain Number 1 Region: 75-257
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.05e-75
Family F-box associated region, FBA 0.0000018
Further Details:      
 
Domain Number 2 Region: 11-90
Classification Level Classification E-value
Superfamily F-box domain 5.89e-17
Family F-box domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000007670   Gene: ENSECAG00000009631   Transcript: ENSECAT00000009987
Sequence length 277
Comment pep:known chromosome:EquCab2:2:39938409:39950126:-1 gene:ENSECAG00000009631 transcript:ENSECAT00000009987 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ECPEARAMAVGNINELPENILLELFTHVPARQLLLRCRLVCSLWRDLIDLVTLWKRKCLR
EGFITEDWDQPVADWKIFYFLRSLHRNLLHNPCAEEGMASWQIISNGGDHWRVESLPGAH
GTDFPDSRVKKYFVTSYDLCLKSQLVDLKAEGYWEELLDTFRPDIVVKDWFAARADCGCT
YRIGVHLTSADYITLASFEPPPVTIEQWNDARWTEVSHTFSDYPPGVRHILFQHGGQDTQ
FWAGWYGPRVTNSSIIISHNMTRTLAPSTAQPEATQG
Download sequence
Identical sequences F6YW73
ENSECAP00000007670 9796.ENSECAP00000007670 ENSECAP00000007670

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]