SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000007728 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000007728
Domain Number 1 Region: 24-143,325-612
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 8.37e-53
Family Integrin alpha N-terminal domain 0.0000378
Further Details:      
 
Domain Number 2 Region: 109-330
Classification Level Classification E-value
Superfamily vWA-like 1.63e-41
Family Integrin A (or I) domain 0.000000125
Further Details:      
 
Domain Number 3 Region: 771-909
Classification Level Classification E-value
Superfamily Integrin domains 1.41e-27
Family Integrin domains 0.003
Further Details:      
 
Domain Number 4 Region: 612-770
Classification Level Classification E-value
Superfamily Integrin domains 3.56e-21
Family Integrin domains 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000007728   Gene: ENSECAG00000008485   Transcript: ENSECAT00000010058
Sequence length 1167
Comment pep:known chromosome:EquCab2:13:19176913:19212278:-1 gene:ENSECAG00000008485 transcript:ENSECAT00000010058 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSCIIVMRLLLSGPFLFAPASSYNVDVRHVQSFSYPHAGRHFGYRVLQVGNGVVVGAPG
EGNSTGNLYQCQPGTGHCLPVSLSGSNYTSKYLGMTLARDPTNENLLACDPGLSRTCDQN
IYLSGLCYLFHQNLRGPVLQGRPGYQECIKGNVDLVFLFDGSRSLQQNEFQKIVDFMKDV
MKKLSNSSYRFAAVQFSTTYKTEFTFSDYVQWKDPDVLLATVKHMRQLTNTFGAINYVVT
NVFRQDLGARPDATKVLIIITDGEATDKGNTDAAKDIIRYIIGIGKHFKTKESQETLHNF
ASTPTKEFVKILDTFEKLKDLFTELQKKIYVIEGTSRQDLTSFDMELSSSGISADLSKGR
GVVGAVGAKDWAGGFLDLKVDLQDDAFVGNEPLTKEVKEGYLGYTVAWLPSRGLPSLLAA
GAPRYQHVGRVLLFQESENRDHWSQIQKINGSQVGSYFGGELCGVDVDQDGETELLLIGA
PLFYGEQRGGRVFVYQRKQLGFEVASELQGDPGYPLGRFGAAITALTDINGDELMDVAVG
APLEEQGAVYIFNGRHGGLSPEPSQRIEGTQVLSGIRWFGRSIHGVKDLGEDGLADVAVG
AEGQVIMLSSRPVVDVITLLSFSPAEIPVHEVECSPSASNKKKEGVNITVCFQVKSLIPQ
FQGLLVANLTYTLQLDGHRTRSRGLFPGGRDKLSGNTAVTPVKSCTEFWFHFPVCIQDLI
SPINVSLNFSLWEEEGTPRDQRAGKDIQPILRPSPHSETKEIPFEKNCGEDKKCEANLGL
SFSPTRSKVLRLTPSASLSVELTLTNSGEDAYWVRLGLTLPRGLSFRKVEMLKPHSQIPV
SCEELPEEPKLLTRTLSCNVSSPIFKTGSSVVIQVMFHTLMNSSWGDFVELHANVSCENE
DSGLLEDNSATTSIPVLYPVNILTEDQENSTLYISFTPKGPKIHHVKHIYQVKIQPSVHD
HNVPTLEALIGVPWPHSKGPIMHKWRVEMEPPSTCYHEDLEMPPSMAEPCLPGAKFRCPL
VFKQEILIQVIGTVELVGEIEASSMFSLCSSLSISFNSSKHFHLYGSNASLAQVIMKVDI
VYEKEMLYLYVLSGLGGLLLLLLIFMALYKVGFFKRNLKEKMEASADASDGIPGEDSGQP
ASEEEAMDPGCRDPLHEEEAQDGGGKD
Download sequence
Identical sequences F6Z146
ENSECAP00000007728 9796.ENSECAP00000007728 ENSECAP00000007728

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]