SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000007729 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000007729
Domain Number 1 Region: 1-156
Classification Level Classification E-value
Superfamily E set domains 4.39e-57
Family Cytoplasmic domain of inward rectifier potassium channel 0.00000366
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000007729   Gene: ENSECAG00000009854   Transcript: ENSECAT00000010059
Sequence length 221
Comment pep:known chromosome:EquCab2:10:18532544:18535412:1 gene:ENSECAG00000009854 transcript:ENSECAT00000010059 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWRVGNLRRSHLVEAHVRAQLLQPRVTPEGEYIPLDHQDVDVGFDGGTDRIFLVSPITIV
HEIDSASPLYELGRAELARADFELVVILEGMVEATAMTTQCRSSYLPGELLWGHRFEPVL
FQRGSQYEVDYRHFHRTYEVPGTPVCSAKELDERAEQASHSPKSSFPGSLAAFCYENELA
LSCCQEEDEEEEAKEGDEGEAEDEAASPRVLTPTLALTLPP
Download sequence
Identical sequences F6Z140
9796.ENSECAP00000007729 ENSECAP00000007729 ENSECAP00000007729

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]