SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000007780 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000007780
Domain Number 1 Region: 429-485
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.93e-23
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 2 Region: 345-401
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.42e-22
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 3 Region: 306-358
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.28e-18
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 4 Region: 470-522
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.11e-18
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 5 Region: 118-174
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000000000575
Family KRAB domain (Kruppel-associated box) 0.0034
Further Details:      
 
Domain Number 6 Region: 391-423
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000423
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000007780   Gene: ENSECAG00000009869   Transcript: ENSECAT00000010116
Sequence length 552
Comment pep:known chromosome:EquCab2:13:39666815:39673504:-1 gene:ENSECAG00000009869 transcript:ENSECAT00000010116 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSADGRGIRATQDKKKAQELPGPRHLCQEMLSEAEEVVPLGATRESPHIKMEPEEQHPEV
VLQEDGTQGARGSVPLSLGSKEKALFLPGGALPSPQIPVLSREGRTRDRQMAAALLTAWS
QMPVTFEDVALYLSREEWGRLDHTQQSFYGDVLQKRNGLSLGFPFGRPVWASQVQGKGEA
SSSCRQTDEEEKRGVCRGAIEVGKEEPAPSLAALRDVKALRTRAGRTQGDILQCRRQAAN
SQSPGPAKNDGQPGPPEERQPKLAPPDTSLLKAQEGHLPEKPKEGETGAPENSEESLPAD
GDTSKKTYKCEQCGKGFSWHSHLVTHRRTHTGEKPYACTDCGKRFGRSSHLIQHQIIHTG
EKPYTCPSCWKSFSHHSTLIQHQRIHTGEKPYVCDRCAKRFTRRSDLVTHQGTHTGAKPH
KCPICSKCFTQSSALVTHQRTHTGVKPYPCPECGKCFSQRSNLIAHNRTHTGEKPYHCLD
CGKSFSHSSHLTAHQRTHRGVRPYSCPLCGKSFSRRSNLHRHEKIHTTGPKALAMLMLGA
AGALAAPSPAPT
Download sequence
Identical sequences F6YU45
ENSECAP00000007780 ENSECAP00000007780 9796.ENSECAP00000007780

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]