SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000007794 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000007794
Domain Number 1 Region: 1014-1139,1305-1461
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.89e-34
Family p120GAP domain-like 0.028
Further Details:      
 
Domain Number 2 Region: 6-150
Classification Level Classification E-value
Superfamily Sema domain 7.32e-24
Family Sema domain 0.012
Further Details:      
 
Domain Number 3 Region: 491-582
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000803
Family Other IPT/TIG domains 0.013
Further Details:      
 
Domain Number 4 Region: 586-672
Classification Level Classification E-value
Superfamily E set domains 0.000000000000191
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.051
Further Details:      
 
Domain Number 5 Region: 669-750
Classification Level Classification E-value
Superfamily E set domains 0.00000000000345
Family E-set domains of sugar-utilizing enzymes 0.074
Further Details:      
 
Domain Number 6 Region: 153-201
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000103
Family Plexin repeat 0.003
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000007794
Domain Number - Region: 814-863
Classification Level Classification E-value
Superfamily E set domains 0.0056
Family E-set domains of sugar-utilizing enzymes 0.076
Further Details:      
 
Domain Number - Region: 311-350
Classification Level Classification E-value
Superfamily Plexin repeat 0.0262
Family Plexin repeat 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000007794   Gene: ENSECAG00000009159   Transcript: ENSECAT00000010133
Sequence length 1529
Comment pep:known chromosome:EquCab2:16:4301439:4349836:1 gene:ENSECAG00000009159 transcript:ENSECAT00000010133 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DVQGTYHGARTLCFEPALDVVAVLDSVVQGTGPCERKRNIQLQPEQLDCGAAHLQHPLSV
LQPLKAAPVFRAPGLSSVAVASVSNYTVVFLGTISGRLLKINLNESMQVVSRRVVTVAYG
EPVHHVMQFDPADPGYLYLMTSHQMARVKVAACAMHTTCRDCVGAADAYCGWCALETRCT
LQQDCANSSQWHFWTSASKGPGGCPAMTVLPAEIDVRQEYPGMILQISGSLPSLSGMDMV
CDYGNNIRTVARVPGPAFGHQIAYCNLLPRDQFPPFPPHQDHVTIEMSVRVNGRNIVQAN
FTIYDCSRIGQVYPHTACTSCLSAQWPCFWCTQQHTCVSNQSRCEASPNPTSPQDCPRIL
PSALAPVPTGGSQSIPVHLANAAFFQGAALECSFGPEEIFEAVWVNESAVRCNQVVLHTT
QKSQVFPLSLQVKGRPARFLDSPDPMTVEVYNCAMGSPDCSQCLGREDLGHLCVWSDSCR
LRGPLQSLPGTCPAPEIRAIEPLSGPLDGGTLLTIRGRNLGRRLSDVAHGVWIGSVACEP
LADRYTVSEEIVCATGPAPEAFSDVVTVNTSKEGKSRERFSYVLSLVHSLEPAMGPKAGG
TRITIHGSDLHVGSELQVLVNDTEPCTELVRRDTSITCMVPGAALPAPVPVCVRLERRGC
LRGNLTFWYMQNPVITAISPRRSPVSGGRTITVAGERFHMVQNVSMAVHHIGREPTLCKV
LNSTLITCPSPGALSNASAPVDFFINGRAYADEVAVAEELLDPEEAQRGSPFRLDYLPDP
QFSTAKREKWIKHHPGEPLTLVIHKEQDSLGLERHEYRVKIGQVACDIQIVSDRVIHCSV
NESLGTAEGQLPITIQVGNFNQTIATLQLGGSETAIVVSIVICSVLLLLSVVALFVFCTK
SRRAERYWQKTLLQMEEMESQIREEIRKGFAELQTDMTDLTKELNRSQGIPFLEYKHFVT
RTFFPKCSSLYEERYVLPSQTLNSQGSSPVQETHPLLGEWKIPESCRPNMEEGISLFSSL
LNNKHFLIVFVHALEQQKDFAVRDRCSLASLLTIALHGKLEYYTGIMKELLVDLIDASAA
KNPKLMLRRTESVVEKMLTNWMSICMYSCLRETVGEPFFLLLCAIKQQINKGSIDAITGK
ARYTLNEEWLLRENIEAKPRNLNVSFQGCGMDSLSVRAMDTDTLTQVKEKILEAFCKNVP
YSQWPRAEDVDLEWFASSTQSYILRDLDDTSVVEDGRKKLNTLAHYKIPEGASLAMSLTD
KKDNTLGRVKDLDTEKYFHLVLPTDELAEPKKSHRQSHRKKVLPEIYLTRLLSTKGTLQK
FLDDLFKAILSIREDKPPLAVKYFFDFLEEQAEKRGISDPDTLHIWKTNSLPLRFWVNIL
KNPQFVFDIDKTDHIDACLSVIAQAFIDACSISDLQLGKDSPTNKLLYAKEIPEYRKIVQ
RYYKQIHDMTPLSEQEMNAHLAEESRKYQNEFNTNVAMAEIYKYAKRYRPQIMTALEANP
TARRSQLQHKFEQVVALMEDNIYECYSEA
Download sequence
Identical sequences F6YTL9
9796.ENSECAP00000007794 ENSECAP00000007794 ENSECAP00000007794

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]