SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000007811 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000007811
Domain Number 1 Region: 1008-1211
Classification Level Classification E-value
Superfamily vWA-like 1.93e-59
Family Integrin A (or I) domain 0.00012
Further Details:      
 
Domain Number 2 Region: 148-337
Classification Level Classification E-value
Superfamily vWA-like 5.19e-57
Family Integrin A (or I) domain 0.0001
Further Details:      
 
Domain Number 3 Region: 1230-1433
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.07e-34
Family Laminin G-like module 0.044
Further Details:      
 
Domain Number 4 Region: 536-702
Classification Level Classification E-value
Superfamily Fibronectin type III 2.27e-22
Family Fibronectin type III 0.0013
Further Details:      
 
Domain Number 5 Region: 828-917
Classification Level Classification E-value
Superfamily Fibronectin type III 3.42e-18
Family Fibronectin type III 0.0012
Further Details:      
 
Domain Number 6 Region: 354-440
Classification Level Classification E-value
Superfamily Fibronectin type III 2.7e-17
Family Fibronectin type III 0.00086
Further Details:      
 
Domain Number 7 Region: 447-532
Classification Level Classification E-value
Superfamily Fibronectin type III 6.67e-16
Family Fibronectin type III 0.0011
Further Details:      
 
Domain Number 8 Region: 31-115
Classification Level Classification E-value
Superfamily Fibronectin type III 9.42e-16
Family Fibronectin type III 0.0013
Further Details:      
 
Domain Number 9 Region: 739-826
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000361
Family Fibronectin type III 0.0012
Further Details:      
 
Domain Number 10 Region: 922-1005
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000153
Family Fibronectin type III 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000007811   Gene: ENSECAG00000009462   Transcript: ENSECAT00000010157
Sequence length 1796
Comment pep:known chromosome:EquCab2:9:63051340:63266433:1 gene:ENSECAG00000009462 transcript:ENSECAT00000010157 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKIFQCKMQYSLFQAFLAVAYFYTSVQGQVAPPTRLRYNVLSHDSIQISWKAPRGKFGGY
KLLVTPASGGKTNQLNLQNTATKAIIQGLLPDQNYTVQLIAYSKDKESKPAQGQFRIKDL
EKRKEPKPRVKVVDKGNGSKPSSPEEVKFFCETPAIADIVILVDGSWSIGRFNFRLVRLF
LENLVTAFDVGSEKTRIGLAQYSGDPRIEWHLNAFNTKDEVIDAVRNLPYKGGNTLTGLA
LNYIFENSFKPEAGARSGVSKIGILITDGKSQDDIIPPSRNLRESGVELFAIGVKNADEN
ELQEIASEPDSTHVYNVAEFDLMHTVVESLTRTVCSRVEEQDKEIKASALATIGPPTELI
TSEVTARSFMVNWTHAPGKVEKYRIVYYPARGGKPEEAVVDGSVSSTVLKNLMSLTEYQI
AVFAIYAHTASEGLRGTETTLALPIASDLELYDVTENSLRAKWNPVAGASGYLILYAPLT
EGLAGDEKEMRIGDTHTDIELRGLLPNTEYTVTVYAMFGEEASDPVTGQETTLPLSPPRN
LRISNVGSNSARLAWDPSSEKISGYRIVYNNADGTEINEVEVDPVTTFPLKGLTPLTEYT
VAIFSIYDEGQSEPLTGIFTTEEVPAQQYLEIDEVTTDSFRVTWHPLSADEGQHKLMWIP
VYGGRAEEIVLLEDQDSYVVEGLEPGTEYEVSLLAVLDDGSESEVVTAVGTTLDSFWTEP
ATTIAPTRPVTSVFRTGIRNLVVDDETTSSLHVKWDISDSSVQQFRVTYLTAQGDPAEEV
VGTVMVPGSQNNLLLKALLSNTEYKVTVTPIYDDGEGVSVSAPGKTLPPSGPQNLRVSEE
WYNRLRISWDPPSSPVKGYRIVYKPVSVAGPTLETFVGANINTILITNLLSGMDYNVKIF
ASQASGFSDALTGVVKTLFLGVTNLQADQIQMTSLCARWQVQRHATAYRVVIESVQDTKK
QETIVGGGTTRHCFYGLQPDSEYKISVYTKLQEIEGPSVSIMEKTQSPPTQPPTFPPTVP
PAKEVCKAAKADLVFMVDGSWSIGDENFNKIINFLYSTVGALNKIGADGTQVAIVQFTDD
PRTEFKLDAYKNKETLLDAIKHISYKGGNTKTGKAIKHVRDTLFTEESGTRRGIPKVIVV
ITDGRSQDDVNKISKEMQSDGYSIFAVGVADADYSELVSIGSKPSARHVFFVDDFDAFKK
IEDELITFVCETASATCPLVHKDGTDIAGFKMMELFGLVEKDFSSVQGVSMEPGTFNVYP
CYRLHTDALVSQPTKYLHPEGLPSDYTISFLFRILPDTPEEPFAIWEILNKNSDPLVGVI
LDNGGKTLTYFNYDYSGDFQTATFEGPEVRKIFYGSFHKLHIIVNKTLAKVVIDCKQVGE
KAINASANITSDGVEVLGRMVRSRGPNGNSAPFQLQMFDIVCSTSWANEDKCCELPALRD
EETCPELPHSCSCSEISKGPLGPAGPPGGPGLRGPKGQRGEQGPKGPDGPRGETGPPGPQ
GPPGPQGPSGLSIQGMPGMPGEKGEKGETGLPGPQGIPGAVGSPGRDGSPGQRGFPGKDG
SSGPPGPPGPIGIPGAPGVPGITGSMGPQGALGPPGVPGAKGERGERGDLQSQAMVRAVA
RQVCEQLIQSHMASFTAILNQIPSHSSSIRTIQGPPGEPGRPGSPGTPGEQGPPGTPGFP
GSAGVPGTPGERGLTGVKGEKGNPGIGTQGPRGPPGPAGPSGESRPGSPGPPGSPGPRGP
PGHLGVPGPQGPSGQPGYCDPSSCSAYGVGAPHPDQPEFTPVQDELEALELWGSGI
Download sequence
Identical sequences F6ZNX3
ENSECAP00000007811 9796.ENSECAP00000007811 ENSECAP00000007811 NP_001157342.1.31192 XP_005613254.1.31192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]