SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000007898 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000007898
Domain Number 1 Region: 431-687
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.37e-72
Family Eukaryotic proteases 0.0000000351
Further Details:      
 
Domain Number 2 Region: 25-137
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-29
Family Spermadhesin, CUB domain 0.00000102
Further Details:      
 
Domain Number 3 Region: 181-293
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.3e-22
Family Spermadhesin, CUB domain 0.0000825
Further Details:      
 
Domain Number 4 Region: 365-435
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000107
Family Complement control module/SCR domain 0.0000466
Further Details:      
 
Domain Number 5 Region: 306-368
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000806
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 6 Region: 133-177
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000559
Family EGF-type module 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000007898   Gene: ENSECAG00000009519   Transcript: ENSECAT00000010255
Sequence length 695
Comment pep:known chromosome:EquCab2:6:34515391:34524075:1 gene:ENSECAG00000009519 transcript:ENSECAT00000010255 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDKLPEMWCIVLFPLLTWVYAEPTMYGEILSPNYPQAYPNEIEKSWDIEVPEGYGIKLYF
THLDMELSEDCAYDSVQIMAGDLEEGKLCGQRTSKNPSSPIVEEFQVPHNRLKVIFRSDF
SNEERFTGFAAYYVAVDVNECKDFADAPCSHFCNNFIGGYFCSCPPEYFLHDDMKNCGVN
CSGGVFTALIGEIASPNYPNPYPENSRCEYQILLEEGFQVVVTMRREDFDVEPADSEGHC
ADSLIFVSRNQRFGPYCGHGFSGPLNIETKSNALDIIFQTDQTEQKKGWKLRYHGDPIPC
PKQVAANSVWAPEKAKYVFKDVVEITCKEGFEVVQGSVSSTNFYSTCQSNGKWSNSELKC
QPVDCGSPEPIEHGKAKDPEHTLFGSVTRYTCEEPYYYMENEEGGVYRCAGNGSWVNEVL
GTELPKCIPVCGVPKETFEGKQRIFGGSVADIKNFPWQVFFSSPRAGGALIDEYWVLTAA
HVVEENRNPVMYVGSTSVVTSALTHAQRLIAESVIIHPGWEFLDTPETRKNFDNDIALVR
LKDPVKMGPTVSPICLPGTSSEYDLSLGDLGLISGWGRTEARDHVYKLRGAKLPVASLEK
CRQVKGNNPRVNINSFVFTDNMICAGGERGIDSCDGDSGGAFAIQHPNEEAPKFYVAGLV
SWGPQCGTYGIYTRVKNYVDWIMKTMQGYSSPNED
Download sequence
Identical sequences F7BQD6
ENSECAP00000007898 9796.ENSECAP00000007898 XP_001492637.3.31192 XP_008537370.1.77740 XP_008537371.1.77740 XP_014596036.1.31192 ENSECAP00000007898

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]