SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000007919 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000007919
Domain Number 1 Region: 8-123
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.15e-34
Family Spermadhesin, CUB domain 0.00022
Further Details:      
 
Domain Number 2 Region: 138-261
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.63e-19
Family Spermadhesin, CUB domain 0.0034
Further Details:      
 
Domain Number 3 Region: 260-296
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000131
Family LDL receptor-like module 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000007919   Gene: ENSECAG00000009754   Transcript: ENSECAT00000010278
Sequence length 489
Comment pep:known chromosome:EquCab2:3:534164:583907:-1 gene:ENSECAG00000009754 transcript:ENSECAT00000010278 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKHIPATQCGTWVRTSNGGHFASPNYPDSYPPNKECIYVLEAAPRQRIELTFDERYYIEP
SFECRFDHLEVRDGPFGFSPLIDRYCGVKSPPLIRSTGRFMWIKFSSDEELEGLGFRAKY
SFIPDPDFTYLGGILNPIPDCQFELSGADGVVRSSQVEQEGKTKPGQAVDCIWTIKATPR
AKIYLRFLDYQMEHSNECKRNFVAVYDGSSSIENLKAKFCSTVANDIMLKTGVGVIRMWA
DEGSRLSRFRMLFTSFVEPPCTGSTFFCHSSMCINNSLVCNGVQNCAYPWDENHCKEKKK
AGLFEQITKTHGTIIGITSGVVLVLLIISILVQVKQPRKKVMTCKTAFNKTGFQEVFDPP
HYELFSLRDKEISADLADLSEELDSYQKLRRSSTASRCVHDHHCGSQSSSTKQSRTNLSS
MELPFRNDFAQPQPMKTFNSTFKKSSYTFKQAHECPEQALEDRVMEEIPCEIYVRGREDS
AQASISIDF
Download sequence
Identical sequences F7BD49
9796.ENSECAP00000007919 ENSECAP00000007919 ENSECAP00000007919 XP_014593851.1.31192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]